Identifiers and Description

Gene Model Identifier

Contig11464.0.g112

Standard Name

None

Aliases

Contig11464_0_g112

Description

Tubulin-tyrosine ligase family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam03133 ) Tubulin-tyrosine ligase family
  • ( pfam04174 ) A circularly permuted ATPgrasp

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007707302.999564368270328e-76Tubulin-tyrosine ligase family
protein
SGDYBR094W0.000009999254677478949PBY1 SGDID:S000000298, Chr II
from 432036-434297, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11464.0.g112(coding)
ATGAATCAGTTTATGCTTCATAGAACTCAAGCCTACGGATAGAATGATAACATTTAAAAG
CAATTGATAAATGACACCACTAAGATTGCTAAACAATAATAATAAAAAGTTCATGGAAAA
CTTTATAAATTCGATAAAACTAGCTTTCTTGAAAATGAAGCCACATCCTTGCTTGATATT
TCTGTTAGAGAGAAGACGCGAAATAAAAGTCTAGACAGAACAGATATTTTATTTATGAAT
AAACGTTTAAAACGAAGAAACTTTGCATAATTGCCTAAGGCGATAATTGAGAAACAAAGT
GATTTTAACAAATTAGAAAAATTAAGTAAAATCTAACATGACTTTCAATAGGATGAGGTT
GAAAATATTAAATATGAGAGTTTGAATAAAAAGTCGTTCGATAATACTCAATAGAGATTA
ATAAAAACTTAGGAGGGTTCTTAGAGACAATAGGTTGCTTATTCTTAAAAAATATCTCAA
AATAATAATGGCATTTTACCATAACTTGAGAGGATAGCAGTTTCTCAAAATAATAAAAGA
TTCAATTTGAATAAATAAGATTTTCAAAGAAATATCTAAGGAGGCCTGGTGAAAAAAACT
TAGCATGCTATTAGAGAAGAAACTATTGAGAAGCAAACTAATTCTAAACAATCTTCAAGC
TTCTAAACTATAGAGATTAAGAAAATTAAAGCTTGTATAAATTTTCCTTAATAAAGGTTT
TTATCTAACCAGAGAAGGTAATCTCTCATGTCTTAAACTGACGTCGATAAAGCAGTTTCA
AAGAACATTACACCCAAGAAAGAAAGTGAAAAATAGACTTCAAATATTTTCTTTTAGTCT
CTGCACAATTCTTCGATTAGAACTTAATCAGTGATACCACAAAGAGATTCATAAATAAAA
GACTTAAATCCGTTGTCAACTAAACTTACAAATCTCTATGAAAAAGAATAGCAATCAATT
AAAAGTAACAAATCATCCTAATTATCTGAATTGGTGAAGATGCAAAGATACAACACTCAA
AACACTAATATAAATGTGTAGTAAAATACTTCAAAGAATAACAATATCTAAACTAATAGC
TTAAAGAGAGATAGTGTGGGATCTATAGATACTCTGAGAAAATTTAATTCCTTAAAAATA
CATGAAAAAACTGAAAAACAATCTAGTGCAGATTTAAGTCAGTCAAGTGATTAAAATTTA
TTGAACCCTTTATAGTCAACTCAAAACATTCTCAATGCATATTCTACTTAGTAAAATTTC
AATTCAAACAATAACATCAAGTCTAAGACATTAAGGTAATTGTCTTAACAAAATTAGAAC
ATTGAATCTCCAAATAAAGCTCAAAATAGAGATAAAGTTTAAAGAACGAAACAAATTGAA
ACTTTATTGAGCAATAAATAACGCATTTAGCTAAATAAAATTGGATTTAACAATAAAGAA
GCAAAGCCAAGGGAAATTATTAGATAGTATCTGAAAAGAAACAATCAAAAGAATGCCGAA
GACTAGTTAGTCGTCATGATTAAATCTAATGAAAATCATATCAAGCGAGAAGTTCAGAGA
AGAGGCTGGATGGATAATTTAATAACTAGCTCTAATATGTATGATATAAAGTTCGAAATA
TAAGATTAATAGTCAGATTACACGAATTTGAAGCCTTATCAACTATTCAATCATTTTCCA
AATAATACTGAGGTTACTACAAAATCGGGCTTGATGAAAAATCTCTATTAAAACTCATCT
TAAAACTTTAATGTTGACAAATTTTTCCCTCGATCTTATGATTTAAGTGATGTTAGATAA
TCAGATGAATTCCTTTTAGATTTTTAATAAACATCAATTTTCACATATATGAAAAAGCTC
TATAATTTCTTCAAAACTCAACTTGGAATATAAATGTCAGACATTTATTAGGAAATAAGC
TCTTTAAAGAAGGGATACAATTATAGAGAGATTAAAAGTAATTTAGTGTTAAAATATTTG
CAAATGATACCTGACGATGAAAAGTTTATTTTAAACATTAAGTTGACAGAAAAAGCATTG
ACTTATTGCAAGAAATTCATCAAGAATAAAACTTTTAATGACCTTGTAAAATCAGATTTA
ATTGGTTAACTGAAAATTGATCCAGATGATATAGTTACCGAAAAAACAAAGCGAGCTATC
TAAAGGCTCTCTAAGTTTGATCCTCCTTACTTGAATAATTAAGATCTTATAAAAATTCAC
AATGACTAATTTTCAATTGATGGTCTCAATAACATTTGGATTGTAAAACCTTCTTATAAC
GCTCGAGGTCTGGGTATTTATTGTGTAAATGATGCCTCAGAAGTGACTTAAAATGGATAG
AGAAAAGTTCAATCAAAAGTCATTTAGAAATATATTGAGAAACCTTGCTTGCTTGAGCTT
TAAAACAGTTAAGATCCGACAAAAACAGAACTTAGAAAATTTGATATTAGAATATGGGTT
TTAGTAACATCCTTTGATCCACTCTAAATTTATGTGTTCTCAGACTACTACCTGAGAATA
TGTGGATCTGAGTTCAGCTTGGATGATATTTAAGACAATTATAAGCACTTGTCTAACTAT
ACCATACAGAAAAACAATCAAAGAGTCGAAAATAAAGATGAGGATCTTACAATGAGCATG
GGGTAGTTTCAAGATTACCTAATAAAAACTTAAAAAATTGATAGTGACAAAATTTTAGAA
AAGATTTAAATTAGGATGCATGAGATAATAATCAAAACTATGGAATCAGTTCAAGACTCG
ATTGAACATAAAAATAATTGTTTTGAGATGTATGGATTTGATTTCATTCTAGATCACAAA
TTTAACCCATGGCTTTTGGAAGTTAATCTGAGCCCTGCTTGCTAAGAAAGGACTGATTGG
CTAACAGAAATGTTGGATAATATGACATCCGGATTATTTGATATAATTGAATAAAAACTA
TTAAGACTGCATAATGATTTTGATGAATCCTTAAAGAAAAAGATATTGAAAAATACTGAT
TAATAATCAGATAGAAAGTAAAAATGGATCTTAATTCATGATTAAAAAATAACCCTGCCT
TAGCTATCTAAAATCGAAATAAACATGTTTTAAACTGCTTCAAATTTCCTCTATAAAGAC
CCTTAACAAATGCTAGAAATCGTTGGCAAAAAAATTAATCCAAAAATACTGAGAAAATAA
GCCAGACTTTCGAAATAAATTAAGAGAAAGACACTCTTCTGGTTCGAAAAGTTGAATTGA


>Contig11464.0.g112(protein)
MNQFMLHRTQAYGQNDNIQKQLINDTTKIAKQQQQKVHGKLYKFDKTSFLENEATSLLDI
SVREKTRNKSLDRTDILFMNKRLKRRNFAQLPKAIIEKQSDFNKLEKLSKIQHDFQQDEV
ENIKYESLNKKSFDNTQQRLIKTQEGSQRQQVAYSQKISQNNNGILPQLERIAVSQNNKR
FNLNKQDFQRNIQGGLVKKTQHAIREETIEKQTNSKQSSSFQTIEIKKIKACINFPQQRF
LSNQRRQSLMSQTDVDKAVSKNITPKKESEKQTSNIFFQSLHNSSIRTQSVIPQRDSQIK
DLNPLSTKLTNLYEKEQQSIKSNKSSQLSELVKMQRYNTQNTNINVQQNTSKNNNIQTNS
LKRDSVGSIDTLRKFNSLKIHEKTEKQSSADLSQSSDQNLLNPLQSTQNILNAYSTQQNF
NSNNNIKSKTLRQLSQQNQNIESPNKAQNRDKVQRTKQIETLLSNKQRIQLNKIGFNNKE
AKPREIIRQYLKRNNQKNAEDQLVVMIKSNENHIKREVQRRGWMDNLITSSNMYDIKFEI
QDQQSDYTNLKPYQLFNHFPNNTEVTTKSGLMKNLYQNSSQNFNVDKFFPRSYDLSDVRQ
SDEFLLDFQQTSIFTYMKKLYNFFKTQLGIQMSDIYQEISSLKKGYNYREIKSNLVLKYL
QMIPDDEKFILNIKLTEKALTYCKKFIKNKTFNDLVKSDLIGQLKIDPDDIVTEKTKRAI
QRLSKFDPPYLNNQDLIKIHNDQFSIDGLNNIWIVKPSYNARGLGIYCVNDASEVTQNGQ
RKVQSKVIQKYIEKPCLLELQNSQDPTKTELRKFDIRIWVLVTSFDPLQIYVFSDYYLRI
CGSEFSLDDIQDNYKHLSNYTIQKNNQRVENKDEDLTMSMGQFQDYLIKTQKIDSDKILE
KIQIRMHEIIIKTMESVQDSIEHKNNCFEMYGFDFILDHKFNPWLLEVNLSPACQERTDW
LTEMLDNMTSGLFDIIEQKLLRLHNDFDESLKKKILKNTDQQSDRKQKWILIHDQKITLP
QLSKIEINMFQTASNFLYKDPQQMLEIVGKKINPKILRKQARLSKQIKRKTLFWFEKLN