Identifiers and Description

Gene Model Identifier

Contig1144.0.g118

Standard Name

None

Aliases

Contig1144_0_g118

Description

Replication factor C C-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001611802.9996910481190226e-100Replication factor C subunit,
putative
SGDYBR087W5.000518477595783e-71RFC5 SGDID:S000000291, Chr II
from 423765-424829, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1144.0.g118(coding)
ATGCATTCTGAACAAAGACTCTGGGTAGAAAAGTATCGTCCCCTTTGCATCGATGACGCA
AAAGCTATCCATTCTGATACTTATAAAATGTTGTCTTAGCTTGCTCAAAGTGATGATTTC
CCTCACATACTGTTCTATGGTCCCTCTGGTGCTGGAAAGCGTACTTTGACTAAATGCCTC
CTTCAAGAGCTCTACAAGAACAATTCAGTGCACAAGATCAAAAGTGAGCACAAAGAGTTC
AAAGCAAGTGCTACTAGCTCCACAGTAGTTGAATGTGTTGTATTTTCAAGTAATTATCAC
ATCGAAGTTACACCAAGCGATGCTGATAACTAAGATAGAGTTATTGTGCAAAAATTAATC
AAGGAAGTTGCTGGATCTCAATAACTTGATACTAAAGCTTAAAAGTCTTTCAAAGTTGTA
GTTATACATGAATTGGACAATCTTACTAGAGAAGCTCAAGCTGCTCTACGTAGAACTATG
GAAACATACATGCCTTACTGCAGAATTATTGCTAATTGTGAAAGTCTGTCGAAAGTCATC
TAACCATTAAGATCAAGATGCTTACAAGTGAGAGTACCTGCACCAAATGCTTAGGAAATT
GTTGGCGTTCTGGATCAAATTGCGAGAAATGAAAATTTCGATCTTCCCAAACAATTAGCT
TTCTCAATTTGCAACTATTCTCGCAGAAATTTAAGACGTGCAATTATGATGCTTCAAACT
GCTAAGCTTAAGAACGAAAAGCTAAGTGATAAGACTTATGTTCCAGGCCCCGAATATGAA
ACCTACACTCGTGATATTGCAAAGATGGTTGTGATGGAACAAAGTCCCAAGTAACTGAGA
GCAATCAGATCCAAGCTATATGAACTGCTAACTAAGGGTATCACCTCTGATATGATCTTC
CAAGTCTTAGCAAGAGAATTCTTGAAGAAAATGAACTCAGGAGACAAGAACAGTGCTGCT
CTACCAGAAGTTATCAAGCCTGAAGTGTTGAAATTCGCAGTCATGTTTGAACATAGATGC
AAGGAAGGAACTAAAGCCATTTTTCATCTTGAGGCTTTCCTTGCTAGAGTCATGGCAATC
TTTAAGGGATATCAGCTCAAAGCTAACAGCAGATGA


>Contig1144.0.g118(protein)
MHSEQRLWVEKYRPLCIDDAKAIHSDTYKMLSQLAQSDDFPHILFYGPSGAGKRTLTKCL
LQELYKNNSVHKIKSEHKEFKASATSSTVVECVVFSSNYHIEVTPSDADNQDRVIVQKLI
KEVAGSQQLDTKAQKSFKVVVIHELDNLTREAQAALRRTMETYMPYCRIIANCESLSKVI
QPLRSRCLQVRVPAPNAQEIVGVLDQIARNENFDLPKQLAFSICNYSRRNLRRAIMMLQT
AKLKNEKLSDKTYVPGPEYETYTRDIAKMVVMEQSPKQLRAIRSKLYELLTKGITSDMIF
QVLAREFLKKMNSGDKNSAALPEVIKPEVLKFAVMFEHRCKEGTKAIFHLEAFLARVMAI
FKGYQLKANSR