Identifiers and Description

Gene Model Identifier

Contig11298.0.g87

Standard Name

None

Aliases

Contig11298_0_g87

Description

haloacid dehalogenase-like hydrolase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam00702 ) haloacid dehalogenase-like hydrolase
  • ( pfam00122 ) E1-E2 ATPase
  • ( pfam12710 ) haloacid dehalogenase-like hydrolase
  • ( pfam13246 ) Putative hydrolase of sodium-potassium ATPase alpha subunit
  • ( pfam08282 ) haloacid dehalogenase-like hydrolase
  • ( pfam14336 ) Domain of unknown function (DUF4392)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003724609.997093137033517e-262phospholipid-translocating P-t
ype ATPase, fli...
SGDYIL048W9.997093137033517e-262NEO1 SGDID:S000001310, Chr IX
from 261437-264892, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11298.0.g87(coding)
ATGTCTTAAAGTTAGAGCTTTATGATGAACACTGCAATTAACAGCACAAGTAGCCGGAGT
AAAAACTCTGGAGGCTTAAGCTCTCGAAGCAAGAACAAAGTCAAAGATGTGATTTTGACA
ATTGGAGGAAATGAAAAAGATGAGCAATATAGACAGCCACTTATTCATAAGGGAAATTAA
ATTCTGTAATTAAAATAGGAACAGTTAGGGTGCATGTATAGAGTATACAGATTCCTCGGA
ATGACTATTTCAAGAGAAAAAAGAACACTTTGGTTAAATGGCAGATCAGAGCCAAGCTAC
TATCTTCCCAATAAAATGAATAACCAGAAATATTCAATTCTTACTTTCATACCAGTTGTG
CTATACAACGAGTTCAAGTTTTTCTTCAATTTATTCTTCTTGCTTATCGCATTATCTCAG
CTTGTCCCATTCTTGAGAGTTGGTTTCTTGATCACTTATTTGGCCCCACTAATGCTTGTC
CTTTCTATCACAATGTGCAAAGAGGCATATGATGATTATTAAAGATACAGGAGAGACAAA
GATATGAATTTAAAGAAGCACGAAGTTTTGACTAGTACAGGATTTAAAGCAATGAGCTCT
ATGGATCTTAAAGTAGGCCACATTGTGAAGGTACATCAAAATGAAAGATTGCCTGCTGAT
CTCGTTTTACTGTATACAACTGAGAAAACAGGATCAGTATTCATAAGAACAGATTAATTG
GATGGAGAAACTGATTGGAAGCTTCGTAAAGCTGTACCTTTTACATAAAAGATTTCTCCT
CCAGAAACGATTTATTTTTTCAAAGCTTTTATAAGAGCACTTCCACCTAATGACGAGATC
TATGATTTTAAAGGATACATGAAAGATGAGGTCAGTGGATAAATGGAACCCCTTTCATTG
GAGAATACTCTTTGGTAAAATACAGTTCTTGCTTCACCAGGTTTTATCCTTGGCATGGTA
GTTTATGCTGGAAAAGAAACAAGAGCTCAAATGAACTCAAAGATGCCAAGATCTAAAGTG
GGACTGTTAGACTAAGAAATAAATTTCTTATCAAAGGTTTTATTCATCCTCATGCTAGTT
ATTTCTGCTCTCATTATAGTTGGTGATGGTTTCGTTGGTTCATGGTACTTTAAATACTTT
AGATTTGTACTATTACTCGCTTCTATTATTCCTATTAGTTTAAGAGTGAACTTGGATATG
GCAAAAATCTATTATTCTTATGGAATATCTCATGACCCTGAAATTGAAGGTACAATTGCT
AGAAATTCAACTATCCCTGAGGAGTTAGGTAGAATTTAATTCCTTTTAACAGATAAGACT
GGAACCCTAACTTAAAATGACATGATCTTTAAAAAGATAGCCATGGAACACGCTTAATTC
ACAGAAGATACTTTACCAGAAATGTAAGACTATTTGAAAAAGAGTTGTGAAAAGTCTAAC
GGCCCTTGTGGAGATTTAGACTAAAGCTACTAAAGCGATTAAGACTTAAAGAGAAGTATG
GATCAAGCACTCAATGTTTCTACCATGAAGTAAAAGAATAAGAGACGCTAGATTTAGTAA
GACAATGGTGGAAGGAAGAAGAGAAGAGAACTTCACTTTATTGTGAAAGATATGATTCTT
GCTTTGGCACTTTGTCACAATGTTACACCAACCTATCCTGATGAAAACGATAGAACGAAA
AAAGAACTCCAAGCTTCCTCTCCAGATGAGGTTGCTCTTGTTAAATTTGCAGAATCTTTA
AATATGAATCTGATTTCAAGAGAGGAACAGTTTGTTCAAATTAAAAATGCTGTTGGTGAA
TTTGAAGAATATGATATTTTAGCTAACTTCCCTTTCAGCTCTGAAAGCAAACGCATGGGA
ATTATTCTGAGACATAGATAGTCAGGTAAAATAGTTTTTTATCTTAAGGGAGCTGAAACT
GTCATGGAGAAAAAAGTAAAGCCAAATTAAAGAGCTTCTTTAGTAGAATCTTGTGAGAAT
TTAGCAATGGAAGGTCTTAGAACACTTGTCATAAGTTAAAAGATACTAAGTGAATAATCA
TTTGAAGAATTTGACTTGAGGTATAAGAGAGCAAAGACATCACTAAACGATAGAGAAAAG
CTTACAAATGAAGCAATAGAAAGCCTAGAAGAGGATATGGACTATTTAGGAGTTACTGGT
GTTGAAGATAAGTTATAAGAAGAGGTTATGCTAACAATCGAAACTTTGAGGTCAGCAGGA
ATTTAAGTTTGGATGCTTACTGGTGATAAGATTGAAACTGCAAAGTGTATTGCCATTTCA
GCTGGTTTACAAGGAAAGAGATAAAGAGTTTTTGAAATGAAAGATATGAGCTCAGTATAA
GATGTCATGCTATCACTTGGTGAGCTTGAAAGAAAAGTAAATGATTGCATGCTTATAATC
GATGGAACCACATTATCTGTCGTATTGTCTAAACCTAATGTTGAAGAGAGATTCTTTGAA
GTTGCTAAAAGTTCTCCTTCAGTTTGTATTTGCAGATGTAGCCCTACTTAAAAAGCTATT
GTCGCTAAAAGAATTTAGCATTACACAAGAAAGAGAATAGCTTGTGTAGGTGATGGTGGA
AACGATGTAGGCATGATTCAAGTAGCTGACGTTGGTATAGGTATTGTGGGTAAAGAAGGT
ATGTAAGCCTCTTTAGCTGCAGATTTTTCAATTCTTCAATTCAAGTATTTAACACAATTG
ATCCTCTGGCATGGAAGACTATCTTACAAAAGATCTGCAGTGCTTTCTCAATTCGTCATT
CACAGAGGTCTTATCATTTCAATTATACAAGCTGTGTTTTCAATTATCTTTTACTATGTA
TCAATCCCAATATATAACGGTTATCTTATGATGGGTTACACTACTATATACACAGCTTTA
CCAGTTTTTGCATTGGTTTTAGATGAAGATGTTGATTTATAATCTGTTAAAAAGTTCCCA
CCATTGTATAAGACCTTACAAAAGGGAAGATCCCTGAACTTCAAAACATTTTTAATTTGG
GGATGTGTAATCATGCTCTTTTCCATAATATTCTTTAATGATTCTTTTGTGAACATAGTC
AGCATCACATTCACAGCTCTTATTTACATTGAAATTTTGAATGTATTTACAGAAGTCAAT
AAAGTTAAGCAAAAGATGATAATTTCTGTCATGATCACTATTTTCAGTTACATGTTTAGT
ATATTGTTCTTCAGAAACTACTTCGATGTCTCAGCTTTCACAATGGACTTTATGCTAAAA
GTACTAGTTATTGTAGCTATATGCTGGCTACCAATACATCTTTTAAAGAAAATAATAGAA
TTCATTTCACCTAGTGAAGAATCAAAAGTCAAAAATAGTTTTAAATGA


>Contig11298.0.g87(protein)
MSQSQSFMMNTAINSTSSRSKNSGGLSSRSKNKVKDVILTIGGNEKDEQYRQPLIHKGNQ
ILQLKQEQLGCMYRVYRFLGMTISREKRTLWLNGRSEPSYYLPNKMNNQKYSILTFIPVV
LYNEFKFFFNLFFLLIALSQLVPFLRVGFLITYLAPLMLVLSITMCKEAYDDYQRYRRDK
DMNLKKHEVLTSTGFKAMSSMDLKVGHIVKVHQNERLPADLVLLYTTEKTGSVFIRTDQL
DGETDWKLRKAVPFTQKISPPETIYFFKAFIRALPPNDEIYDFKGYMKDEVSGQMEPLSL
ENTLWQNTVLASPGFILGMVVYAGKETRAQMNSKMPRSKVGLLDQEINFLSKVLFILMLV
ISALIIVGDGFVGSWYFKYFRFVLLLASIIPISLRVNLDMAKIYYSYGISHDPEIEGTIA
RNSTIPEELGRIQFLLTDKTGTLTQNDMIFKKIAMEHAQFTEDTLPEMQDYLKKSCEKSN
GPCGDLDQSYQSDQDLKRSMDQALNVSTMKQKNKRRQIQQDNGGRKKRRELHFIVKDMIL
ALALCHNVTPTYPDENDRTKKELQASSPDEVALVKFAESLNMNLISREEQFVQIKNAVGE
FEEYDILANFPFSSESKRMGIILRHRQSGKIVFYLKGAETVMEKKVKPNQRASLVESCEN
LAMEGLRTLVISQKILSEQSFEEFDLRYKRAKTSLNDREKLTNEAIESLEEDMDYLGVTG
VEDKLQEEVMLTIETLRSAGIQVWMLTGDKIETAKCIAISAGLQGKRQRVFEMKDMSSVQ
DVMLSLGELERKVNDCMLIIDGTTLSVVLSKPNVEERFFEVAKSSPSVCICRCSPTQKAI
VAKRIQHYTRKRIACVGDGGNDVGMIQVADVGIGIVGKEGMQASLAADFSILQFKYLTQL
ILWHGRLSYKRSAVLSQFVIHRGLIISIIQAVFSIIFYYVSIPIYNGYLMMGYTTIYTAL
PVFALVLDEDVDLQSVKKFPPLYKTLQKGRSLNFKTFLIWGCVIMLFSIIFFNDSFVNIV
SITFTALIYIEILNVFTEVNKVKQKMIISVMITIFSYMFSILFFRNYFDVSAFTMDFMLK
VLVIVAICWLPIHLLKKIIEFISPSEESKVKNSFK