Identifiers and Description

Gene Model Identifier

Contig1124.1.g111

Standard Name

None

Aliases

Contig1124_1_g111

Description

EF hand

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00036 ) EF hand
  • ( pfam13499 ) EF-hand domain pair
  • ( pfam13405 ) EF-hand domain
  • ( pfam13833 ) EF-hand domain pair
  • ( pfam13202 ) EF hand
  • ( pfam13720 ) Udp N-acetylglucosamine O-acyltransferase; Domain 2
  • ( pfam10591 ) Secreted protein acidic and rich in cysteine Ca binding region
  • ( pfam12763 ) Cytoskeletal-regulatory complex EF hand
  • ( pfam05042 ) Caleosin related protein
  • ( pfam04876 ) Tenuivirus major non-capsid protein
  • ( pfam09373 ) Pseudomurein-binding repeat
  • ( pfam03963 ) Flagellar hook capping protein - N-terminal region
  • ( pfam04760 ) Translation initiation factor IF-2, N-terminal region
  • ( pfam09124 ) T4 recombination endonuclease VII, dimerisation

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006898509.998819815181669e-76EF hand family protein
SGDYOR257W3.9990760533890984e-36CDC31 SGDID:S000005783, Chr XV
from 811008-811493, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1124.1.g111(coding)
ATGGCATCAAGATCAAGACCTAAGTTCAACGCTAAGAAATACGAAAGACCAGGCCTAACT
GAAGACGAAATCGAAGAAATCAAGGAAGCCTTTGACCTATTCGATACAGACGGCAGTGGC
TCCATCGACCCAAAAGAGTTGAAGGCTGCTATGCAATCTCTTGGATTTGAAGCTAAAAAT
CAAACAATTTTCCAGATGATTAGTGACTTGGACAAGAACAAGTCTGGAACAATCGACTTT
GAGGAATTCCTAGACATGATGACTGCAAGAATGAGCGACAAGGACACTCGTGAAGATATT
TCAAAAGTTTTCAGGCTTTTCGATGACGATAACACTGGCACAATTACTCTTAGAAATTTG
AGAAGAGTTGCCAGAGAGTTGGGTGAAACCATGACCGACGAGGAACTTTAAGAAATGGTT
GACAGAGCTGACTCAAACGGAGATGGTGCTGTCACTCTCGACGACTTCTTCAATATCATG
ACCAAGAAGACCTTCGCCTGA


>Contig1124.1.g111(protein)
MASRSRPKFNAKKYERPGLTEDEIEEIKEAFDLFDTDGSGSIDPKELKAAMQSLGFEAKN
QTIFQMISDLDKNKSGTIDFEEFLDMMTARMSDKDTREDISKVFRLFDDDNTGTITLRNL
RRVARELGETMTDEELQEMVDRADSNGDGAVTLDDFFNIMTKKTFA