Identifiers and Description

Gene Model Identifier

Contig11192.0.g81

Standard Name

None

Aliases

Contig11192_0_g81

Description

haloacid dehalogenase-like hydrolase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam12710 ) haloacid dehalogenase-like hydrolase
  • ( pfam13246 ) Putative hydrolase of sodium-potassium ATPase alpha subunit
  • ( pfam00122 ) E1-E2 ATPase
  • ( pfam00702 ) haloacid dehalogenase-like hydrolase
  • ( pfam08282 ) haloacid dehalogenase-like hydrolase

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002947609.997093137033517e-262phospholipid-translocating P-t
ype ATPase, fli...
SGDYAL026C9.997093137033517e-262DRS2 SGDID:S000000024, Chr I f
rom 99697-95630, Genome R...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11192.0.g81(coding)
ATGAAGGGTAAATAGGAGGATTAGCTTAAGCTTATAGGGCCGGTATTCGAACAGAAACCT
TAGACTTCACAGTTTCAAGAAAGCTCTAACGAACATTAAGCCGAAGAAACTACTGTAATA
ACAAAACAAAAAATAAGGAACCAAGTTGCCTCTGGTATTTATGATTTCAGAGTAAATCAA
GTTCCTGATAAAAAGGATAAACGTTTTAAAAGTAACATGATCTCAACTTGCAAGTATACT
TGGTGGAATTTTATCCCCAAAAATTTGTTTATTCAATTCACTAAACTTGCAAACGCCTAC
TTCCTGCTTATCTTGATATTACAAGTAATTAAGCCCGTTAGTATCACCAAAGGGACGCCC
GCCATTTTGCTGCCATTAAGTGTTGTTGTAGCAATGAGTGCCATTAAAGATATTATAGAA
GATTTCAAAAGGTATAGATCTGACTAGGCTGAAAACAGAAAGAAGTGTCTAGCTAAAAGT
TATATTACTGGATAATTTGAGTTGACAGAATGGGAATAATTAAAGGTAGGCTAAACTGTT
AAGATACTTTAAGATGAACCTTTTCCTGCGGATATACTTTTAATAAATTCTTCTCTAAAT
GGAGGTATTGCTTATGTAGAGACAAAGAACCTTGATGGAGAAACTAATTTAAAACATAAG
AATTCAGTAAAAGAAGTAATTCCTATTTCTTAGAACGAGAATTAAGTGCTTAAATTTGAA
GGTCATATATTTTGCGAAGCACCAAATGACAGGATTTATAAATTTGAAGGAAATATGAAC
TCGTAAAGCCTTTCAAAAGAAGTTTCATTATCTGCAGATAATATACTATTGAGAGGAGCT
TCTTTGAGAAACACTGATCACATATATGGAGTTGTTGTATTTACTGGGCATGATACGAAG
ATTATGCTTAATTCTTCTTCCGCAAGAAATAAATTCTCAAGAAACGAGTAAACTACAAAT
GTTTAGATTTTATTGGTCTTTATGCTTTAACTTTCTGTTTGTTTCTTCGGATCAATGTTT
GGTACAATCTGGGAAAGAGATAATAGAACTGAAACCTACAATTACTTGAAAATTGAACTT
TTATATAGCGAGAGTGAAAATAGAAGCTGGACTGAGTAATTCTTTACTAGGTTCGGAACA
TGGATTCTTTTATTTACAAATTTCATTCCTATTTCTCTAACGGTTACAATTGAAGTAGTT
AGAATGGCTCAAGGTTTCTTTATGTCTTGGGACACTGAGATATACGATCTTGAGAAAGAC
ATGTCAACCAAAGTTTAATCGAGTAACTTGAATGAAGAGCTTGGGTAAGTTCACTATATC
TTCTCAGATAAGACAGGTACACTCACTTGTAATATTATGGAATTTAAGAAATTCTCGGTT
GGAGAAGTTTCATATGGTATTGACGGTTTCAACCTAAAAGATAAGATGGCTAATAGATAT
CCTAATTTTGAATAAGATAACATTACTAATGTTAACTTCGAGGACCCAGTATTCTTTGAA
CACTTGAATAACCATCACAACTCTAATTATAAAAACATATAAAATTACCTTGATTGTCTT
GCTCTTTGTCACACAGTAATCATTGAAGAAAAAGATGGGAAAATATTCTATAATGCATCC
TCTCCAGATGAACTTGCATTAGTAAATGCTGCAAAGTTTTTTGGGGTTGCTTTTGCGGGC
AGAGATGAACAAAGCAATATGATAATTAAAAGATAGAATGGAGGAACTTAAACATTCGAG
CTTCTTAATGTGTTAGAATTCAATTCTACTAGAAAGAGAATGAGTGTAATCATCAAAGAT
TAACATGGCTAAATAAAATTGATATGTAAAGGTGCAGATTCTATAATTGAATAGAGACTA
AAGAAATCCCAAGAAAATTAAGGTCTTTTTTAGAAGACAGATGTGCACCTCTAACAATAT
GCAAAAGATGGTTTAAGAACTCTTTTAATTGCTGAAAGAATCCTAGATCCAAATTACTAC
TTAGAGTGGTCAAAAGACTACTATCAAGCTTCGTTACTTACTAAAGGCAGGGATGATGCT
ATTGATGAGTGTGCAGAAAAAATTGAAGTAGAGCTCAGTATAGTGGGTTCAACAGCTATA
GAAGATTTACTACAAGAGAAGGTTGGCGAGACAATTTTTTCATTAAAAGAAGCTGGAATA
AAAGTGTGGGTTCTAACTGGAGACAAAATAGAAACTGCTATCAATATTGGCTACAGTTGT
TAATTGTTAAATAATGATATGCTTCAAGTTGTTATTGATGGTAGTAATGGCTAGGAAATT
ATTGCTGCTCTTAATGATGCCGAAATCAAAGTCAAAGAAAATAGGCAAGATCAAAAGATA
GCAATTATAGTTAGTGGAGGAGCTCTTATAGATATAGCGGCATAAAAACAAATTCAAGAT
CAATTTATTGATGTGTGCAGTTATGCTCAAGTTGTCTTAGCTTGTAGAGTTTCCCCTAAG
CAAAAAGCAGATATAGTAAATATGATAAAAGATAAATATCCCTCACTCACAACTTTAGCG
ATTGGTGACGGTGCTAACGACGTTAATATGATAACAGCAGCACATATTGGAGTTGGAATA
AGTGGAAAAGAGGGTCAATAAGCTGCAAGAGCTGCTGATTATGCAATTGGTTAGTTTAAA
TTCCTTCAAAATTTACTCTTTGTTCATGGAAGAGAATCATACAGAAGAAACTCATACTTG
ATTTGCTATATGTTCTATAAAAATGCGCTATATGTCATGCCTCAATTTTGGTATGGTATC
GTTAATACTTTCTCTGGCCAAACTTTGTACGAATCTTGGGTTTATTAATTATTCAACATT
GTATTTACTGCACTTCCAATCATGTGGTATGCTCTATTTGATAGTGAATTTGACAGAAAA
GATTTACACTCTGATCCAAAGAAATACGCAAATGGTCCAGCAAAGAGACTTTTTAATAAG
ACAATCTTCTGGAAATGGATGCTATATGCTACTTGTAAAGCAGTGCTCATAATGTTCCTT
TTAGCTTGGACTTTTGAGAATTCATTAAATCGCAAGGGTTAAACTTCTTCTTTCTGGGTC
TATGGAATGATTGTTTACTCTATAATTGTGATCTTGGTTAATGTCGAAATTCTTTTCTAA
ACAAATAACCACAATTTTGTGAGCATAATAATATTCATAGGTTCAATCGCATCTTTCTAT
GCGGTTTATGCTGTAGAGAACACGTTAGACTTAGTTCCCACTCTTTAAGGAACCTTTTTC
TTTATTTGGATTTCTCCTTAATACTACCTTGTAATTATTTTCATGGTACTGCTTCAGCTC
TTTGTGTAAATGACTTAAAGAGATTTAGCTTTAATTTACTACGACAACCAAGATTAATAG
CAAGGAGTTCATAAAAATCTCAAGGTTTAATAAGAAAATCATTAATACTAGACTACTAAA
AACATCTAATCTGAGACACCAGGTGATTAATCTCGTTTCCATAGAGCCTCAACTCATAAA
GGTTTTGCTTTCAGTCAAGAAAGAGGTAACGATCCAATCGTTATGGAAAGATTGCCTACA
AATAAGCAAATTCAAAAAATGATGAGCAATAATTTTGAGAAATAGAACTCAATGGACCTC
TATGGAAACAGATCAAACAAAGTTGCACCTTTGAATGCTTCAATTAAGAGTAATTCAATT
ATGCAGGCTGATTAGAGTGATCTCAATGCAGATTGA


>Contig11192.0.g81(protein)
MKGKQEDQLKLIGPVFEQKPQTSQFQESSNEHQAEETTVITKQKIRNQVASGIYDFRVNQ
VPDKKDKRFKSNMISTCKYTWWNFIPKNLFIQFTKLANAYFLLILILQVIKPVSITKGTP
AILLPLSVVVAMSAIKDIIEDFKRYRSDQAENRKKCLAKSYITGQFELTEWEQLKVGQTV
KILQDEPFPADILLINSSLNGGIAYVETKNLDGETNLKHKNSVKEVIPISQNENQVLKFE
GHIFCEAPNDRIYKFEGNMNSQSLSKEVSLSADNILLRGASLRNTDHIYGVVVFTGHDTK
IMLNSSSARNKFSRNEQTTNVQILLVFMLQLSVCFFGSMFGTIWERDNRTETYNYLKIEL
LYSESENRSWTEQFFTRFGTWILLFTNFIPISLTVTIEVVRMAQGFFMSWDTEIYDLEKD
MSTKVQSSNLNEELGQVHYIFSDKTGTLTCNIMEFKKFSVGEVSYGIDGFNLKDKMANRY
PNFEQDNITNVNFEDPVFFEHLNNHHNSNYKNIQNYLDCLALCHTVIIEEKDGKIFYNAS
SPDELALVNAAKFFGVAFAGRDEQSNMIIKRQNGGTQTFELLNVLEFNSTRKRMSVIIKD
QHGQIKLICKGADSIIEQRLKKSQENQGLFQKTDVHLQQYAKDGLRTLLIAERILDPNYY
LEWSKDYYQASLLTKGRDDAIDECAEKIEVELSIVGSTAIEDLLQEKVGETIFSLKEAGI
KVWVLTGDKIETAINIGYSCQLLNNDMLQVVIDGSNGQEIIAALNDAEIKVKENRQDQKI
AIIVSGGALIDIAAQKQIQDQFIDVCSYAQVVLACRVSPKQKADIVNMIKDKYPSLTTLA
IGDGANDVNMITAAHIGVGISGKEGQQAARAADYAIGQFKFLQNLLFVHGRESYRRNSYL
ICYMFYKNALYVMPQFWYGIVNTFSGQTLYESWVYQLFNIVFTALPIMWYALFDSEFDRK
DLHSDPKKYANGPAKRLFNKTIFWKWMLYATCKAVLIMFLLAWTFENSLNRKGQTSSFWV
YGMIVYSIIVILVNVEILFQTNNHNFVSIIIFIGSIASFYAVYAVENTLDLVPTLQGTFF
FIWISPQYYLVIIFMVLLQLFVQMTQRDLALIYYDNQDQQQGVHKNLKVQQENHQYQTTK
NIQSETPGDQSRFHRASTHKGFAFSQERGNDPIVMERLPTNKQIQKMMSNNFEKQNSMDL
YGNRSNKVAPLNASIKSNSIMQADQSDLNAD