Identifiers and Description

Gene Model Identifier

Contig11125.0.g67

Standard Name

None

Aliases

Contig11125_0_g67

Description

hypothetical protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002211809.996149531968772e-161hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11125.0.g67(coding)
ATGGCAGATTTGTTTAAGGAGTACGACTCCTCATCTAGTTCCTCTGATGACGAAAATCAC
AAGAAAAAGGAAGATGATAACTACGAGATGGATTTCATTCCAAAAAGAAAACCTCAAGAA
GCAGTTTTTGAAGAAGGAGTGAAAAGCATGAATGATTTCTTGGAATAAATTAACAAATTC
GAGAAGATCACAAACTCCAGACTCGTTGATCTCTGGAAGATCAAAGATACAGCTTTCTAG
CCTCTTAAAGTTACAATAGACATTCAAGAATACATGCCAGGTCTTTTTGATTTGCTTAAA
CCTGAGTAGAAAAATGAAATATCTAAGGTCATATCAGTCTTTTCTTTCCTCCAGATTGAA
ACACACAACTTGAAGTATGAGATCGAGCAGAAGTTCTTCGACCCCTTGATCTATTTCGGT
GAGAGCGGTCTAGTTTTCGAAGAAATTGGAGAGGACCAAGCTGGTGAGTAAGAGATACAA
ATGAGCAGAATGCTCGCAGTTTACAAAGATCTCTTCGAAACTATTAAGAAAATCGTGGCA
CTAACCAAGAACATTATCTACTAGATGAACGGGCTATATAATAGTAAGTCAAAACTGTAT
AGTGGGTTCTTTAAGAAATAAATCTATGAGGAGATGTTCAATAATTTAGGATCTATTTTG
ACTACTTTGTACATCGTGGACTTGATTATTATTGAGAATTCTAATTTCGAGAGCTATTGG
CAATAGTACAATAAGATGTTCCTCATTGCAAAGAATGATCCAACCAAGTATAACATGACT
GATAGAAAAATCAAGAAAATCTAAAAGTTTTGCTCCAAAATCTACTCAAACATTTTATGT
GGTTAACTTTATACTAACTATCTCGATCAACTTTACAAAGTCATCTTATTGGAAGCTGGT
AGAGAACTTGTTTTTAAGAATAAAGAGTTCAACTCCAAGTTCGTGGAGTATTTGAAACGC
AGAATTGAAGATGTTGGGATGCTCTTATCAAACCCAGGTGACATGAAATCTCACATGGAA
TATATGAATCTGTTGATCATGTACTCCCTCTACCGCAAGATCTTCGACACCGAAGACAAA
AAGATCTACAAGAAGATTTGGGCTCTCTAGAAATTGTGCCCAATCATCATTTTGTACAAT
AATATCTCAGTTAATGCAGGTAACTTCCTGGTCAGTGTCTGTCCACTGAAAAAGAAGTCA
ACTCTTGAACCTAAAGACATCAACTAGTTCTTAGGAGAGCAGACTAAACTTAAAAATGAT
ACATTTGCTGCTCAGGTGAATCTTTACTACTTGCGTCTTGTCCCCTGGATTGTAAGAATG
AACTCAGATATACTTAAGGATAACATCAGCAATAGTTCAATGATGAACAGAGACTTCTTG
AAGTAAAGAAGTATTATGATACTTGATGGTGTAAAGTTAGCTGTGGAGATCAAAAGACAT
GTTAAGAATCTTTTGTTGATGCACTAGGCTTCAGGAGTGCAATTAAATTAAGATAGACTC
AAAGATATAGTCTAAGCTATTGAGATGCTCAAAGCCATAGAAATTGAGTTCAAGACCAAG
AAATACATGATAAATCAATGGGTAGTATTAATCAATAGATACTTGCAAGAAGAGATCAAC
GTAGTTATGCAGAAAGGTATGGAGAACTTATATAAAAAGAAGAAGTCAGCTACATTTGAG
TACATGTTCTACTTGATGAAGACAATTATTGGGTGCTTAAATGGCGGTTAGAACATCCTG
AGAAAGACAGTCGTGGCTCACTGCAAAAACCTTGTAAACGAGGAAGTTTTCTCAAAGAGT
GAGCATAATGAACTTGAGAATTACACTTGGATGATTGACATCATTACTAATTGGGAGTGG
TATGTTAGAAAGAGTACCAGATGCAGGTTCTTGTATTGGAATAGATCATTGTTTCCAATC
TTCTTCCAAAAGATAGCTTCTGACAAGCATAGATTGAACCAACTTAACTACTTCTTGATG
TCTATGAATGATCCCTTAGATATGCTAGTTAACATCAAGCACTTAGACACAGCTCAAACA
GCAATTAACAACTATAAGAAAGAAATTTATCAAGCATTCACCTCAAATATAGTGACTCCA
ATATGTAGGAAAATTGAAGAGGAACTCAGATTATAGATTCATTAAGTCATTATTAGCAAT
TTAAGACAAAGAAACCCGACTAGAGACAAGATCATGGACTGGGCTATGTACACAAGAATG
AGTGATTTGTACCTATTTGAGAAGAAAATATGCTTAAAAGAGGAAGTCAAGCATTACCTC
AATAAGATATTCTACGAAATGACCGCCTTATCACCTCATGATTGGAAAACATACCAGCAT
ATGCGTATCTTGGCTAAAGAAAAGTTCCAAATTGACGTAGTTCCTTCACATTTGCCCTCT
TAAACTTTGGAATAAGGGGTAGATATACTGTATTTGCTCAGAAACTTGCAATCATATGTT
TCAAAGTACAATTACAACTTGCATACCCAAGTATTCATCGAGACTACCAAAGACACGAAG
TAAATCAAAACTATATCTGTGAATCAAATGCTCTTTTCAATAAAGACTCATGGTGTTGGT
ATTTTGGATTCAGCAGTCAATACTTTTTACAAGTTCCTAATTAAGAAGTTTAGCGTTTTC
TCAGAGTTTCTTTATGATGATTTCATTCACAATCCATTACTTTAAGAGCAAAGATTCTTT
ATGAGCAATAAGGAGAAGTTAAATGGATAATATCCATATGAAAGAGCTGAAAAAGTAGCT
AAAGCTATTAAGAAACTTGGAACACTTAAGGGAGGTATTACATTCTTGGATAAATTTAGA
CAGCTTATCACTCAATTCGGTAATGCCCTAGGTTTCGTAAGAATGATAAGAAACGCTTCA
CTCAAGGATAACTCAAACTTAATTAAGTATATTCCAAATGTCCTCGATGAGGTAGTATTC
GAAAACGTAGCAAGTGATTTGGGTATCAAGGCAGAGACTATGGAAGCTTGCAAGATGTTT
GACATGAGTATCAGAATGCTGAGAGATCAAGCTGGTGATGCTACAGATTTCTTGAGAAGA
ATTGGAAAGAGTTTTGAAGGTGTGTTTGATGATGCTGAGTGTGCCCATCTCAAGCTTTTC
TACATCATGATTCCACCTCTTACTCTCAACTACATCGAGTACATCAAGAAAGGCAAAGAA
AAGATTTTCAAAAAGAACAACAAAGACGCTTTCATTTCAGAAGATGGTTTCCCCCTGGGA
GTGGCTTATCTTCTAAAAATCCTTAATTAAATTGAGAACTTTGAATCTTTGAATTGGTTC
GATCACATGAAACAAAAGTTCAGAAAAGACCAGAAAGGAATTCAACAGAGAATTGAGAGA
CTTGGAGGTGCTGCTTAGCTCCAGCAAAATACTATGAACGAGGATGAGCAACTTGAAGAC
CAAATGAGTATTAAGAGACTTCAAGATCTTGACAAAGAATTCGAGTTGCTTAATTACTGC
TTTAGCGCTTCCCTAATTCTTTTCAAAGAAATTTGA


>Contig11125.0.g67(protein)
MADLFKEYDSSSSSSDDENHKKKEDDNYEMDFIPKRKPQEAVFEEGVKSMNDFLEQINKF
EKITNSRLVDLWKIKDTAFQPLKVTIDIQEYMPGLFDLLKPEQKNEISKVISVFSFLQIE
THNLKYEIEQKFFDPLIYFGESGLVFEEIGEDQAGEQEIQMSRMLAVYKDLFETIKKIVA
LTKNIIYQMNGLYNSKSKLYSGFFKKQIYEEMFNNLGSILTTLYIVDLIIIENSNFESYW
QQYNKMFLIAKNDPTKYNMTDRKIKKIQKFCSKIYSNILCGQLYTNYLDQLYKVILLEAG
RELVFKNKEFNSKFVEYLKRRIEDVGMLLSNPGDMKSHMEYMNLLIMYSLYRKIFDTEDK
KIYKKIWALQKLCPIIILYNNISVNAGNFLVSVCPLKKKSTLEPKDINQFLGEQTKLKND
TFAAQVNLYYLRLVPWIVRMNSDILKDNISNSSMMNRDFLKQRSIMILDGVKLAVEIKRH
VKNLLLMHQASGVQLNQDRLKDIVQAIEMLKAIEIEFKTKKYMINQWVVLINRYLQEEIN
VVMQKGMENLYKKKKSATFEYMFYLMKTIIGCLNGGQNILRKTVVAHCKNLVNEEVFSKS
EHNELENYTWMIDIITNWEWYVRKSTRCRFLYWNRSLFPIFFQKIASDKHRLNQLNYFLM
SMNDPLDMLVNIKHLDTAQTAINNYKKEIYQAFTSNIVTPICRKIEEELRLQIHQVIISN
LRQRNPTRDKIMDWAMYTRMSDLYLFEKKICLKEEVKHYLNKIFYEMTALSPHDWKTYQH
MRILAKEKFQIDVVPSHLPSQTLEQGVDILYLLRNLQSYVSKYNYNLHTQVFIETTKDTK
QIKTISVNQMLFSIKTHGVGILDSAVNTFYKFLIKKFSVFSEFLYDDFIHNPLLQEQRFF
MSNKEKLNGQYPYERAEKVAKAIKKLGTLKGGITFLDKFRQLITQFGNALGFVRMIRNAS
LKDNSNLIKYIPNVLDEVVFENVASDLGIKAETMEACKMFDMSIRMLRDQAGDATDFLRR
IGKSFEGVFDDAECAHLKLFYIMIPPLTLNYIEYIKKGKEKIFKKNNKDAFISEDGFPLG
VAYLLKILNQIENFESLNWFDHMKQKFRKDQKGIQQRIERLGGAAQLQQNTMNEDEQLED
QMSIKRLQDLDKEFELLNYCFSASLILFKEI