Identifiers and Description

Gene Model Identifier

Contig11090.0.g28

Standard Name

None

Aliases

Contig11090_0_g28

Description

Glycosyl transferases group 1

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam13692 ) Glycosyl transferases group 1
  • ( pfam00534 ) Glycosyl transferases group 1
  • ( pfam08007 ) Cupin superfamily protein
  • ( pfam08660 ) Oligosaccharide biosynthesis protein Alg14 like
  • ( pfam08795 ) Putative papain-like cysteine peptidase (DUF1796)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_009542004.000392704867155e-81similar to chitobiosyldiphosph
odolichol beta-...
SGDYBR110W1.9990871925214856e-61ALG1 SGDID:S000000314, Chr II
from 458872-460221, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11090.0.g28(coding)
ATGATAGGATATAGAGGAAACTCTCTCCCTGCGACTCATTTGAACGCGAAGAACATTCAT
GCAAGATATTTATCAACTAAATTGATTGATAAGTTAAGAGAGCTGCCACGTGCTCTTTAT
GTTCTGTATGCCCTCTTAAGAATCATAATTCAAATCATTCAACTTATCTGGGTGTTCTAA
AGTGAGCACTATGACTATGTAATTATGCAAAACCCACCTTGCGTACCATTGATGCTTGTA
CTTGCACTCTTAAAGATACTAAGAGTAAACAAGCAACGTGTCATTATAGATTGGCATAAT
TATGGATACAGTATAATGAGAGTCAATCGGGTGAATAAATTCCTAGTTGGTGTTGGAAAG
ATTTATGAGATACTCTTTAGTAAGATTGCAGGAGATTATCATTTGTGTGTGTCTCAAGCC
ATGCAGGTTGATTTAATTAACAAGTTTAAACTTAAATCATAGCCTCATGTCCTATACGAC
CTTGCAACCAAGAAATTTAAGTAAGTTAACATGCAAGAGAAACACGAATTATTTGCAAAA
TATGACCTTAAAGATACAGCTCAGGAAGAAAACAAAACTTCCTTAACAGAATACAATCCT
GACTCAAAGTCTTACCAGTATAAGTAAAATAGAAAAGCACTTATTATTAGCTCTACATCA
TACACTCCAGATGAAGATTTCATGGTTATGATTTAAGCACTTGACAAACTTTAAGAAAAA
ATTGACTAATTATCTGCTATCAACAAGAATTTCAAATTCCCATAAATTTAAGTGATAGTG
ACAGGAAAGGGTCCTCAGAAAGAGCACTATCAGCAAATATTTGAAAACAGAAACCTCTAG
TGGAAGGATATCAACATAAGAACAGCTTGGCTTGAAATTGATGACTATCCAAAGATTGTT
GCAGCTTCAGATTTAGGGGTCTGTTTGCATTATTCTTCTAGTGGTCTTGACCTACCTATG
AAAGTGGTCGATATGTTTTCTGCTAAGCTTCCTTGCCTTGCCTACAAATATTTAGCAATT
GATGAACTCGTCTAAGATGGCCAAAATGGAAGAGTGTTTAGCGATGATTCAGAACTAATG
GAGCAAATATTTGATACATTGAAAGCTTTTGAATCCTAGAATTAAGAAGGAGCCACAGAT
ATTATCAGAAAGTACAAAAAGAATCTTGAAAAATTCAATGAAGAAGATTGGGATTCTTAA
TGGAAAAGAGTTGTCCTAGGAAAGATTATTGTATGGAATAAGTGA


>Contig11090.0.g28(protein)
MIGYRGNSLPATHLNAKNIHARYLSTKLIDKLRELPRALYVLYALLRIIIQIIQLIWVFQ
SEHYDYVIMQNPPCVPLMLVLALLKILRVNKQRVIIDWHNYGYSIMRVNRVNKFLVGVGK
IYEILFSKIAGDYHLCVSQAMQVDLINKFKLKSQPHVLYDLATKKFKQVNMQEKHELFAK
YDLKDTAQEENKTSLTEYNPDSKSYQYKQNRKALIISSTSYTPDEDFMVMIQALDKLQEK
IDQLSAINKNFKFPQIQVIVTGKGPQKEHYQQIFENRNLQWKDINIRTAWLEIDDYPKIV
AASDLGVCLHYSSSGLDLPMKVVDMFSAKLPCLAYKYLAIDELVQDGQNGRVFSDDSELM
EQIFDTLKAFESQNQEGATDIIRKYKKNLEKFNEEDWDSQWKRVVLGKIIVWNK