Identifiers and Description

Gene Model Identifier

Contig11042.0.g61

Standard Name

RRP12

Aliases

Contig11042_0_g61

Description

NUC173 domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007606308.999409812021828e-43hypothetical protein
SGDYPL012W0.0000000006999585478469937RRP12 SGDID:S000005933, Chr XV
I from 529723-533409, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11042.0.g61(coding)
ATGGAAAAATACATCAGAAGACCAAAGCCTGAAAAACCAGTTCTCCCAAAAGTTCTTAAG
AAATTCGATGCTCTCAGAAGAAGACAGAAGACTCTCTATATCAAGGCATTTGATATCATG
AGTGCAGTCACCTCAGTTCTTAAGGACAGTGTGAATGACTTCTCAGCAACTGCATACTTT
GCTAGCATAGCATAAATGTACAAAACATCAAATATTAGCAGCAACGATTAGATAACTTAG
GAAGCAATTGCATACTGCTTCTCAGCTATTATTTCTATGTTGGACATTGCAGTCATTTAG
AATCAGCATTAGATCATTTTTGACATCATCTCTAATCATATGCTGAGCAACAACACTGAA
TCACAATCAATAGCTAAGTATGGATTGATAGCTCTCTAGTTCTTATTGCATTCTAAGACT
GAATAATAATGGAATGGAAATGATGAGGAAACTGACAAAGCTTATCTCCTTTTAATGAGT
TCTTTAATTGATAGAAGAGGAGAAAAAGTGCAAAAACAAGCATAAAAGTCTCTCTGCATT
TTATTCCAAAACAAGAAGATTGAGAAGCTTGTGAAGCCAATGTCTGCATTCTAGAACTTT
GTGACATAGGTCTTTAATCAATAATTCTAACAAAAGGGAGGTCAAGCTTCTCAAAAGACT
ATTTTACTCTTGAATTTCTTAGCAGCGGCACTATAAATCATGCCATTAAGCTAATGCTGT
GATATTGATACTAAAATTATGAGATTAACATCCTTAGAAGACTCAGCCTTAAAGACACAT
GCCTATTTAACTCTTGAAGTCTTTTATGCATCTCGTAGATTTACCAGCAACCCTGAACAT
GTTGAATAGATTCTTCGTTCTTTACTTGATAACTAGGAAGTTTTGAGTCTCCTTTCAACA
GGGAGATTCCAAATGAATAAAGGACTCTATGAGCAAGAAGAAATGAGAGTAGTCTCATAC
ATTTAATGTACTTCACAAGTTATGGTTAACTACTCAACCACAAGAGGAGCGAGACCTAAT
GATATTCTCAAAAATGCAGCATTCACCGCTCTTAGAATCATCCTAACTTAGAGTTTAAAA
AAGGAGCATTTCCAACAACAAGGTCAAGATGGCATAAGCAGCAATTTGACAGCAGAAATC
CTTAACTTAGATGCCTTATCACTCAATGATTAAATGACTAGCATGATGAGAGGAGGTAGC
AACGGAAAAAATTAAGGTCTCTCTTAAGCAGATAAAGTCATTATATTCATCAGATACTTG
CTCACTTCTAGATTTGAAGACGCCCTAGATAACTGCCTAAAACTCATGAAAACTTTCATT
AAGTAGGTTGGTGACGTTATTCCGGAGTCTGCTGACTTGTTGAATGTTGTTGCACTAATT
AACCCTAAAAGAGATAGTTACAACAGTTGGAAAGATTGCATTGGTGCTTTCTTAGAAGTT
GTTGGAGCAGAAAAGTTTTTCCAAGCTCTTCCAATTCAAGTAGTTAATATTGATATGAAC
AGTTTAACATTTGCAAAAGACAGTAGATCATATATAATTCAGATCATTCCAGCCCATCTA
AAAAACGGAGATTTAGCTTTCTTCATTTCTTATTTCCTTCCAATGCTAAATGCAATTGAT
AAAATGATTAAGTAATTCAAATAATAACAAGGAGGTTTTGAAATTAAAGCCAAGAAGTAC
GAGACTATTATGATTCAAATATGGGAGTTGCTACCTTATTTCTGCCAATACAACAGTCCT
TAATTAAGTTCTGCATTCGCCACTATTATTCCTTATTTAGAGCCAATGATCAACCAAAAT
ATATATGGATTGAGAATCGTAGCTCTTAAGTCATTTTCAACTCTGATTAATCACTGCAGG
AACACATCTGTAGTCTCTGAGGAAATCAAGAAGACAAGAACAGGTTTGAAGAGAATTAGT
TTGGATTACATCGAAGGACTATCAAACCTCTACACTTCATAAAGTGCAGAAACAAATCTA
CCACCCTAAGAGAAACAACAGATCTTAGCCACTCTATAGGATTTCTCCTCTATTGCGATG
AGTGTTAAACTTTCCAATTTGTTCTTGACTGGCTTCGCAAACCTAGTTTTGCAATTCAAT
ACTCATTCAATTACCTCAGAGAAACTGTTAAGCAACTTAGAAGTCTTACTTGCAATGATG
GAAAAAGTAAAGCTCAAGAAAGAAAACTATTTAGCATTAATGAAAGGCCTCAAAGTTTTT
ATTGATAATCAGTCATCCCAAAAGTTTGCTTATAAACTTCTTGCTAAAATCATTGAGAAA
TATGAACTTGAAAATATCGCTGAGCTTTTCTAAATACAGTAAGAGCTTAATCCGCTGCTT
TAAGGTTAAGCTTCTAAGTAAAGACTCTTCCTTATAAAATCGTACATTCAATAATTACAC
AAATACAAAGATGATTAGAGCAACTTACAATAGATTGGAGAATTGCTTAAACTTATGATT
GTGGAATTAATTACTGCTTTCAGTAACACCAATAAAAAGATTAAGAGATAAGCAGAAGAC
ATTTTCAAAAGCATCTTCGAATTGATTATGTACATGAAAGCTTTGCCTTAGTTGTTCTAG
ATGCTTCTAGTTGGTTTTGCAGGCGCTAAAGTCTCAACTCAGAGTGCTACTATTAGAGTT
TTACTCCTACTTTTGAAACTTAACTATCAAAACAAGGATAAGAATGTGAATTCAATCAGA
TTTGAGGACCCTACTTTCTAAGATTTCCTAAGAAAGGTGACTAAAATTATCACTCTATTT
ATGAGAGATCACACCTCAGGCAATGAATTGCACAGATCAGTCCTAAAATACATCAAGACA
GTCGTATCTTTCCTAAATGTTGACTAATTGAAGGGTGAGCTTTGTGAATCTATGTTCTAA
GGTATCTTTGGAATCCAGAGTGACAAAAAGTTGTTTAACAAACATAACATGCTTATTAAG
AAGATTTTAAGCAAATTCATTAAGAAAATGGGTCTCTCATATGTAAAGTCCATCACACCT
GAAACTCATTAAAAGCTAATTGCTTATATCGAAAGAGATAGAAGAAAGCGCCTTAATAAG
TCTAAGAAAATAAGACTCTTAGCTCTTATTGGCAAAGAAAAGAAAGAAGAAGCCCCAACA
GCAGGTGGAGATGTTGATATGAAAGATGGATCAGATAGTTCAGAGGATGAACAGGGTTAT
GAAGAGGATGATGGTGAGCACAGTGAAAAGTATTCTCAAGCATCAGAAGGAAACGATAGT
GACAGTGAAGATGATAGTGATTCAGAGAGTGATAATGATGAAGAAGAAAAGGGAGCAGAC
ATGTTAATGACTGACGAGCAAGATATCCCCAGAGTTGATGACATCCCAGTTGTGAGTAGA
CTAGCCAAGGAAAAGAAACAAATGTAACTGACCAAACTGCCAAAGGTAGAATAATTGAAA
AACAATAAAGAAAGAATTACAAAAATGATAGACGCTGATGAGGAGCAGTTTGAATCTCAC
TTCGTAGAGAACCCCTTCATTAAACTCAGAGAGAAAGCAATGACTAAAAATATCAACTCT
AAGCAACACATGAGCTTAGCAACACTCGAAGGAGATGATAAGAATCACGATATCTACATT
ATGTAGGAGACCGGTAAATTCATGATTTAGGATCTTGAGGAAGAAGAACAAAAGAGCAAG
CTATAAAAGTAGCAACTTAAGAGAACGAGAATGCAGATTGGTTAAGATGTTGAAATGTAA
GAGGATAGTAGCAGCGACGAAGACACCGATGCTCTTAAGAAACGCATGTAGGGCTTAAAC
AAGAAATCATCAAAACCAACTGATTCAGTGAAAGATAACAAACAGTCCAAACAACAGGCA
GCTCTATTAAAGAACAAGAGACAAAAGAAGGGTGAAGACGATGGTCATTTCGTGAAATAC
TCTGGTAATACCTATTAATCATCTAAGGGTAAGGGTGATGTCTTGAAAGCAGGTAAATAT
GAGCCATTCGCTTACATCTAACTCAATCCCAAGATGCTCAACAAAAGATACAAGGATAAA
GCTGTTAAGAGTTTCGAGGGAGTTGTATCACATGGTAAAAAGGTTGGCAAAAGAACTGGA
GAGAAGAAGACAGAGGGATTGTTCTCTGGATTGACATTCAAGAAGGATTGA


>Contig11042.0.g61(protein)
MEKYIRRPKPEKPVLPKVLKKFDALRRRQKTLYIKAFDIMSAVTSVLKDSVNDFSATAYF
ASIAQMYKTSNISSNDQITQEAIAYCFSAIISMLDIAVIQNQHQIIFDIISNHMLSNNTE
SQSIAKYGLIALQFLLHSKTEQQWNGNDEETDKAYLLLMSSLIDRRGEKVQKQAQKSLCI
LFQNKKIEKLVKPMSAFQNFVTQVFNQQFQQKGGQASQKTILLLNFLAAALQIMPLSQCC
DIDTKIMRLTSLEDSALKTHAYLTLEVFYASRRFTSNPEHVEQILRSLLDNQEVLSLLST
GRFQMNKGLYEQEEMRVVSYIQCTSQVMVNYSTTRGARPNDILKNAAFTALRIILTQSLK
KEHFQQQGQDGISSNLTAEILNLDALSLNDQMTSMMRGGSNGKNQGLSQADKVIIFIRYL
LTSRFEDALDNCLKLMKTFIKQVGDVIPESADLLNVVALINPKRDSYNSWKDCIGAFLEV
VGAEKFFQALPIQVVNIDMNSLTFAKDSRSYIIQIIPAHLKNGDLAFFISYFLPMLNAID
KMIKQFKQQQGGFEIKAKKYETIMIQIWELLPYFCQYNSPQLSSAFATIIPYLEPMINQN
IYGLRIVALKSFSTLINHCRNTSVVSEEIKKTRTGLKRISLDYIEGLSNLYTSQSAETNL
PPQEKQQILATLQDFSSIAMSVKLSNLFLTGFANLVLQFNTHSITSEKLLSNLEVLLAMM
EKVKLKKENYLALMKGLKVFIDNQSSQKFAYKLLAKIIEKYELENIAELFQIQQELNPLL
QGQASKQRLFLIKSYIQQLHKYKDDQSNLQQIGELLKLMIVELITAFSNTNKKIKRQAED
IFKSIFELIMYMKALPQLFQMLLVGFAGAKVSTQSATIRVLLLLLKLNYQNKDKNVNSIR
FEDPTFQDFLRKVTKIITLFMRDHTSGNELHRSVLKYIKTVVSFLNVDQLKGELCESMFQ
GIFGIQSDKKLFNKHNMLIKKILSKFIKKMGLSYVKSITPETHQKLIAYIERDRRKRLNK
SKKIRLLALIGKEKKEEAPTAGGDVDMKDGSDSSEDEQGYEEDDGEHSEKYSQASEGNDS
DSEDDSDSESDNDEEEKGADMLMTDEQDIPRVDDIPVVSRLAKEKKQMQLTKLPKVEQLK
NNKERITKMIDADEEQFESHFVENPFIKLREKAMTKNINSKQHMSLATLEGDDKNHDIYI
MQETGKFMIQDLEEEEQKSKLQKQQLKRTRMQIGQDVEMQEDSSSDEDTDALKKRMQGLN
KKSSKPTDSVKDNKQSKQQAALLKNKRQKKGEDDGHFVKYSGNTYQSSKGKGDVLKAGKY
EPFAYIQLNPKMLNKRYKDKAVKSFEGVVSHGKKVGKRTGEKKTEGLFSGLTFKKD