Identifiers and Description

Gene Model Identifier

Contig11028.0.g32

Standard Name

None

Aliases

Contig11028_0_g32

Description

Kinesin motor domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000149209.99679536751975e-103Kinesin motor domain containin
g protein
SGDYPR141C9.996907204735647e-62KAR3 SGDID:S000006345, Chr XVI
from 817923-815734, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11028.0.g32(coding)
ATGTCTTCCATGAAGAAAACAAATACTTAACAAAACACTAACACCACAAATAAGAATTAT
TCCAGTAATAACATCAATCACAATTACAGTGGAAATACCAGTAGCAGCCAGAGTAACACT
AATCGATAGTAGCAAATATTATCTAAGTATCAAAGTAATATGATAAACAATGATGAAGAC
CAGGATCAAGAATTTTATGAAAATAATCAATCACAGTAGAATCAACAGTATCACTCTTAA
CAACAATTAAATAGCAAACCAAGGAAGAGTTAGCAAGAAACCAATGAATAAGAAGATAGT
AAACACCACAAGAAACAAGCCTAGTATAACTCATAAGCCCAATAATAGCAACCATAGAGC
AAAAACTATTAAAATTAAATTGAATTCTATCCACAGCAGCAATAATTGCAAATGTAATAC
CAAAACCAGAGCAGCAATGCAAGCAGTGGTAGATAAAAAAGTCTTAAAAATAATAACTAG
TATAATTTCAACAATCAATAGTACGAACAGCAACAACAGATTAATTCTTATAGAGATAGC
TAGAAACAGAGCTCTAGAAATGGCAACTAGAAAAGTCAGAGAAATAACAATAATCAAAAC
AATAATAAACAAGGGACCGACGATAGTGATAGTAGCAGCAGTAATAGTTTGGATGATGTT
GACCCAGAAGACCTTACAGCTTCAGCTTTTGTTAGAAGATTCAAATTTGCCGATGGTGAT
GAAGACTTAGAAGCTGATGTTAAAAATGAAGTGACCAATTAGAATCAAACTTAAAGTCAG
AGAGATAATAATAATTAAAAAGTAAATACAAATAAAAGCAATAACTAAAATCAATAGAAT
TAAGTGGCATAAAACTAGTATGAAGATGAGAATGATGTCTCAGAAAGCAGTTCTTTTGAA
AATTTTGTAGATTAAGCCAATGAATATGATGACAATTCAGCTGGTAACTCTGACGATGAT
AGTAACTACCACGGTATTTCAAAGTCACAGAGAAGTAATAGGAGAGTGATTCCGATTGAA
TTCGCTAAGAAGCATATTCAAAAGATTGAGGAGGACATGCAGAGGATGCATGAGAGACAT
GTCAAACTACTAAGAGAAATGGATGAAAACTACAAATTAATCGAGAAGGAAACTTAGGAG
TACTATCTGGAGTTTCTCTCAAAGTGGAAGGAAGTTGCCAGAAACAAAATTACGCAATAT
AGAAGAGCTATTGACTAGCTATACACTGATATCGAAAATGCAAAGAGAGATAAGGAAAAA
GCTGTTGAAACTCTTAATGAAAAGACAACTCAGCATCAAATAGAGAAAGCAAAAATGCTT
AAGGAACATAATGAAGATCTACAGATGAGAGATGATGAAATAGACTAATTAAAAAGTTAA
AACAGGAAACTTGAGAGAGAAAATAGTGAATTTAAGTACTAATTAGGAGACAAGGATTTC
AAAATCAGGGAGTTACATAATGACATGTAAAGATTGAGGGAAGAGTATCAAAAAGACAAA
GAAGACTTAGAGAATGAAAATGCAAAATTAGAGATAAGAATTAACGAATATATGGAAAAC
TTGAATGCCAAAACTGAGGAAAATAAAAGCTTGATGCTAAATAATTCATCCTTAACTTAA
AAGCTACAAAGCTTAGACTAGCACTTGTAAAATATAAGTGTGCTTTCCAGTTCCGGTGGT
ACCATGTCAAATGGAAGTGGTTTATAAAATTAACTAGTCTAATAAACCTAAAACCAAAGT
GCTCCTCGCTTTAACATGTCATAAATTAGGATATTGAACTTAAAACAAAAAACTGACATG
TAAAACAATTAAATCTAATCTTAGCCATTTTCAGTAGGAAAGGATAAGATAAGCTTCCAA
AAAAGAAACAACAATAATGACATTATCAAGAGCTAGGGAAATAATAATGTAAATAACTCC
TCATTTATCTATTAATAGCCCACAAAGGCCTTTGCTCAATCTGACGTAAAGATTATTGGA
AACTTTAACACAGCTAAGAACAATTAACCTTAAATGTAGCTGAATAATTTAAAAAGAGAA
GAACACAAAGAAGCACCTGCATAGGATTTCCTATAAACTTAGATAGACAATTTAAGGAAG
GAAATTTAGGACAAAACTTAAGAATATGATAACAAAATAATGAAAGCTAAAAGTGAGATA
TAGCACTAGGCTAAAATATTGTCTAAATATAAAGATGGCTCAAATAAAGTTAAAATACCA
AAGGATAATTTAGAGGCCAGTGAGGCTAGTAAAATTTATTCTGATAATATGAAAGATAGA
AAAAAGTTTGAGGCAGAATAATAATAAATCCTTGGTTAATTGAATCAGAAATTAAATGAT
TTAATCCAGAAGTAAGGGCAGTAAAATTCATTGCAGACACCACTAAAGAGTGCACGTGGC
AGTAAATCAATGAGTCCAAGAAAACATTAAATGCTTAAATAATCTTAAGAACAATAGTAA
AATAGGTTATTAAACTAATCCTATTAAGATGATTCCAATAGTGCAACTATAAAGATGTAG
CCATCTCTAAATCAATCTGTAATAACAAATGATCAAAATAGTGATATCAAATCAATCGAT
TAGCCAACATTAAAATAACAAGAATTTATAAAAGAAGTTACTAATTTACTGAGATTGGTT
GATTAAGTGATACAGAGACTTGATAATCACTCTTCTACAAAAATTATGCAAGAAGTCACA
CTGTTGAGATAAAAACTATATAATAATGGCTAAATAACAAAAGATGATTAAATGGAGCAA
TTTAACAATCAAAATCAAGAGTACTTAAAATTATTGGAAGTAAACAACAGTTGCAAAGTT
AATATGAAAAGATTTGCTGAAATCATAAAGAACTACCAAGAAGATATAAATTACTACAAA
ACTTTAAGAAAGTAGTTGGGCAATATTAATCCAAATGACTTGAGCGACGTTGATATTAGC
AGGATTTCAGAAGTAAATTAATCGATGGTGTCGAAATCTCAGCAACCATCAGTGATTATG
ATGGATGAATAAGAAAGATAAAAGTATCAGGATAAAATCAATGAAATTGGATAAAAAGCT
CAGAAAGGCATCAAGATGAGAGATGATAAAATCAGCTAACTACAGGGTATAAAAGAAAAA
CTCAAGAAAGATCTTATCGAGAAGAGCAAGGCTTACACTGATAAAATTTAAGTGCTAGAA
AAGAAAATTTCAGATTTACAGGATGAAAACCAAAATGGAGAGGCTATGCTGCTAAAATAA
TTTGATGATCTTAAGAAAAGTTATGAGATAATCAAATGCAAACATCAAAGTGAGATGTAT
TAAAGAAAAATGCTTCATAATTAGATAGAAGATATGAAGGGAAAGATTAGGGTGTTCTGC
AGAGTGAGGCCACTAAGCATAGAAGAAGAAGAAAAGGATTAGTTTGGCTTTGTTAAAGTC
ATTGATGGACTCACTATTAAAGTTCCCATACCAAATTAAGGCATGAAAGGTGGATATATT
TAAAGAGACTTCGAATTTGATAGTATATTTGATAAAGATTCTTCATAAGAATAGGTATTC
GAGGATGTACAAATGCTAATTTAGAGTGCGATGGATGGTTTTAATGTTTGTATCTTTGCT
TATGGTCAGACTGGCAGTGGTAAAACATTTACTATGTAAGGTAATGAAGAAAAGCCAGGT
ATCATTCCCAGAGCACTGTAAGAACTATTCAAGCTAAAAAAGAAAATGGAATAAAATAAC
TTTACTGTTTACTTTGAATGCTATATGGTTGAGCTTTATGTTAACTAACTTATTGATTGT
CTTTATGAGAAATAATCTGTAAAGGAAAAAGTTCCCAATTTAGAAATCAGGGAAGAATAA
GGAAGGACGTACATAGAAAATGTTTCTTAAATGCAAATCTAAAGCCTAGATGAATTATAT
TAATACTACAATAAAGGACTAAAAACAAGAAAAGTATCAAGCACAAAAATGAATGATATG
TCTTCTAGGTCTCACATGATCTTCACTGTCCAGATTCAAACAATAAATGAGCAGACAAAG
CAAAATACTTTAAGCAAGATTTCATTTGTAGATTTAGCTGGATCTGAGAGATAAAGTAAG
GCTCAAGGAAATAATGAAAGAATTAATGAAGCAAATTCTATAAATTAGAGCTTGCTTACA
CTTGGCAAAGTTGTGTAACAGTTGACATCAGGGGAAAAGCACATTTCTTATAAAGATAGC
AAATTGACTTAATTAATGAAAGATTCCCTGGGAGGAAACTCAAAAACTCTCATGTTCGTT
AACATTTCACCCTCTGAGTATAACATCCACGAGACAAAGAACTCTATCTTGTTCGGACAA
AAGGCCAAGACTATAGTAAATAACGTATAGAAGAATATCGAATCACAAGAGATGATTAAG
TTGAAAGAAGAGAACGAGTAGTTAAAGAAAATGTTGATGAGTACGCATGGAGGTACAGTC
ATCACAAGCAGCAGCTAGATGATGGTATCTTAGAAAACTGCATTATCCTAGAAAAGATGA


>Contig11028.0.g32(protein)
MSSMKKTNTQQNTNTTNKNYSSNNINHNYSGNTSSSQSNTNRQQQILSKYQSNMINNDED
QDQEFYENNQSQQNQQYHSQQQLNSKPRKSQQETNEQEDSKHHKKQAQYNSQAQQQQPQS
KNYQNQIEFYPQQQQLQMQYQNQSSNASSGRQKSLKNNNQYNFNNQQYEQQQQINSYRDS
QKQSSRNGNQKSQRNNNNQNNNKQGTDDSDSSSSNSLDDVDPEDLTASAFVRRFKFADGD
EDLEADVKNEVTNQNQTQSQRDNNNQKVNTNKSNNQNQQNQVAQNQYEDENDVSESSSFE
NFVDQANEYDDNSAGNSDDDSNYHGISKSQRSNRRVIPIEFAKKHIQKIEEDMQRMHERH
VKLLREMDENYKLIEKETQEYYLEFLSKWKEVARNKITQYRRAIDQLYTDIENAKRDKEK
AVETLNEKTTQHQIEKAKMLKEHNEDLQMRDDEIDQLKSQNRKLERENSEFKYQLGDKDF
KIRELHNDMQRLREEYQKDKEDLENENAKLEIRINEYMENLNAKTEENKSLMLNNSSLTQ
KLQSLDQHLQNISVLSSSGGTMSNGSGLQNQLVQQTQNQSAPRFNMSQIRILNLKQKTDM
QNNQIQSQPFSVGKDKISFQKRNNNNDIIKSQGNNNVNNSSFIYQQPTKAFAQSDVKIIG
NFNTAKNNQPQMQLNNLKREEHKEAPAQDFLQTQIDNLRKEIQDKTQEYDNKIMKAKSEI
QHQAKILSKYKDGSNKVKIPKDNLEASEASKIYSDNMKDRKKFEAEQQQILGQLNQKLND
LIQKQGQQNSLQTPLKSARGSKSMSPRKHQMLKQSQEQQQNRLLNQSYQDDSNSATIKMQ
PSLNQSVITNDQNSDIKSIDQPTLKQQEFIKEVTNLLRLVDQVIQRLDNHSSTKIMQEVT
LLRQKLYNNGQITKDDQMEQFNNQNQEYLKLLEVNNSCKVNMKRFAEIIKNYQEDINYYK
TLRKQLGNINPNDLSDVDISRISEVNQSMVSKSQQPSVIMMDEQERQKYQDKINEIGQKA
QKGIKMRDDKISQLQGIKEKLKKDLIEKSKAYTDKIQVLEKKISDLQDENQNGEAMLLKQ
FDDLKKSYEIIKCKHQSEMYQRKMLHNQIEDMKGKIRVFCRVRPLSIEEEEKDQFGFVKV
IDGLTIKVPIPNQGMKGGYIQRDFEFDSIFDKDSSQEQVFEDVQMLIQSAMDGFNVCIFA
YGQTGSGKTFTMQGNEEKPGIIPRALQELFKLKKKMEQNNFTVYFECYMVELYVNQLIDC
LYEKQSVKEKVPNLEIREEQGRTYIENVSQMQIQSLDELYQYYNKGLKTRKVSSTKMNDM
SSRSHMIFTVQIQTINEQTKQNTLSKISFVDLAGSERQSKAQGNNERINEANSINQSLLT
LGKVVQQLTSGEKHISYKDSKLTQLMKDSLGGNSKTLMFVNISPSEYNIHETKNSILFGQ
KAKTIVNNVQKNIESQEMIKLKEENEQLKKMLMSTHGGTVITSSSQMMVSQKTALSQKR