Identifiers and Description

Gene Model Identifier

Contig10932.0.g110

Standard Name

None

Aliases

Contig10932_0_g110

Description

Repeat of unknown function (DUF1126)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001436909.997093137033517e-262EF hand family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10932.0.g110(coding)
ATGCAACCCAAGAATCTTCCCAACTCGCTTCCATTCTTGCCAGGAAATTCCTACCAAGAC
CCAACAATCACCAGATACCACAAGACCCAATTGCTCGGTGTTAGAGACGGTGCCATTCTA
GAAAAGACAACCAGCTTGCAAGAGAATGTGAATCCAGGCCTGCTTTAATCAATGAGAGAG
GGCAATCCACTCAAGTTGACAGGTATCCCTCAACGTAAGCCACAAGAAAACGATGCCATC
CCCAAAATCGCTCCCAAGTGGCTTAAGTATGACAAACAGGTCCTTTAATTTAACGCTTAT
TTCTAAGAACCAGTCGTCGAGAACCCCAATGAAAATTACAGAGTTAGAAAGTGTATCATC
TACTACTATCTTGATGATGACACTCTTCACATCATTGAGTCAAGAGTTGAAAATAGTGGA
ATTCCATAAGGCATATTTTTGAAACGCCACAAAGTCTAAAGACCCGAAGATGCATCTGTC
AACTACACATGGCAAGATTTGAATTTAGGCTAAAACGTGAATGTCTACGGAAGAGTTTTC
AGAGTTATTGACTGTGATGACTTCACCAGAAGATTCTTCTAAAACGAAGGTGTCCCACTT
AACCCACCCGAAAACTATCCAGACGATCCTTTCCAATAGACTAGAGCTATGATCAACATG
AAATAAAACCCACCCGATCTTGCTGAGCACAAGAACTACATCGAAGTCATGCTTAAGGGA
GGTAGACCAAACAAAAATTTGGACAGCTTCTTGAAAAACGATCGTATTGTTCTCTCATTC
AGCGTTCTCTGGCAAGACAGATCATATGATGGTGGTGACAAGAACTACACTCTCAATTAT
TTCCTCTCTGATAATTCAGTTGAAGTTAAGGAAATTAATGAGCAAAATAATGGCAAGACT
CCATTCCCCATGTTGCTTAAGAGACAAAAATTGGCTAAGACACCAATTTTGACTCATTGC
CCAGGTATGTCATTGAAAAAGGAAGAATTCTATAGCCCAACAGATCTTATGATTGGAGCT
AAACTAAACATCTTTGGCAGAGAGGTTATGATTTACGATTGTGATGCCGCTACAAGACAG
TGGTACATGTAAAATTATCAACAAGAGATGAACCCAATCCAACTTAAGAAACCAAGAGCA
AATATCACTTACCAACCAGTCCCCCCATACAACGGATACGGTACTCCCGAAGACTCACTT
GGTTCAGTTTACTCTCTTCAACCAAAGCCACCCAAGATTGACATGAAAAAGATGTTCAAA
CAAGACATGCACATTTTACGTTTTGATGCCAAGCTTATCTCAACTGAGCCAGATGATGAA
AACAGAAAGTTCATTATCTCATTCTATTGCGGAGACGATACTATTCAAGTGTATGAAGTT
TGTGACAAGAACTCCGGTAGAATTGGAGGTAAATTTATGGAAAGAAAGAAGCATTAAAAC
CCAGTCAACAGAGACTACTATGCTGAGAGAGACTTCCTAATTGGAAGAACCTTCTCACTT
GGTGGATTCAAGTTCCAATTACTTAAAGCTGATGAGTACACTGAGAAATACATGGAGGAC
AACCCAGATATCTTCCCAGAAGCTTCCCTTGAAAACGTACTTAGAAAAATAAAGAAGGGT
GCCTCTGCTTACCGCAACCTTCAAGAATACGTTGTTTCACTCATTTCCTTCCTTGATAAG
AATGGTGATGGCTCTATTTCATTCGAGGAGTTCTGCACTGGCCTTAAGTCAATGAATATT
TTCGTAACCAACCACGAAGAGCACACTTTGATGAGAAAATTCGATCACAACGGAGATGGT
CTTATTTCAATGGAAGAGTTCTATAACACTCTCGCTGAAGTTTTCGATAGCAGACAATGA


>Contig10932.0.g110(protein)
MQPKNLPNSLPFLPGNSYQDPTITRYHKTQLLGVRDGAILEKTTSLQENVNPGLLQSMRE
GNPLKLTGIPQRKPQENDAIPKIAPKWLKYDKQVLQFNAYFQEPVVENPNENYRVRKCII
YYYLDDDTLHIIESRVENSGIPQGIFLKRHKVQRPEDASVNYTWQDLNLGQNVNVYGRVF
RVIDCDDFTRRFFQNEGVPLNPPENYPDDPFQQTRAMINMKQNPPDLAEHKNYIEVMLKG
GRPNKNLDSFLKNDRIVLSFSVLWQDRSYDGGDKNYTLNYFLSDNSVEVKEINEQNNGKT
PFPMLLKRQKLAKTPILTHCPGMSLKKEEFYSPTDLMIGAKLNIFGREVMIYDCDAATRQ
WYMQNYQQEMNPIQLKKPRANITYQPVPPYNGYGTPEDSLGSVYSLQPKPPKIDMKKMFK
QDMHILRFDAKLISTEPDDENRKFIISFYCGDDTIQVYEVCDKNSGRIGGKFMERKKHQN
PVNRDYYAERDFLIGRTFSLGGFKFQLLKADEYTEKYMEDNPDIFPEASLENVLRKIKKG
ASAYRNLQEYVVSLISFLDKNGDGSISFEEFCTGLKSMNIFVTNHEEHTLMRKFDHNGDG
LISMEEFYNTLAEVFDSRQ