Identifiers and Description

Gene Model Identifier

Contig1092.1.g73

Standard Name

None

Aliases

Contig1092_1_g73

Description

TLD

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001511601.0004572433669413e-23TLD family protein
SGDYPL196W0.0000000000008001317446409227OXR1 SGDID:S000006117, Chr XVI
from 175043-175864, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1092.1.g73(coding)
ATGTCATTTCTTCAAAATCTGAATGAGATCTCAGCTGATTCGATTATCTACCCTGGATAA
ATGCTTAAAATAGTCAATCATAATCCTGCAAACCAACATTTACTAATTACACAGGAGTAG
CTTGACAATCAGAATTAAGTGTAGGATGAGGGAGATTTGATGAATAGCAACAACCTGAAC
GAGGAAGTCTTATAAAATTTGTCGACAGCGTCACCAGCTAATATATAGGTTGAAAATCAT
AGTGATTCCTTATTCAATAATTAGAGAAAAGCAAGCAATGCATCTGATGCCAATTATAGC
ACTCAGGAGATCACTATTGACTCCAATGATTTAAGCAAGAACATTCATAGAGCTTAATCA
TAAAGTGCTTATGCCAAGACTGTAGATCTAAACAGCAGAAATCATCTGACCATAAACACC
TAAAAAACTGAACTAAACAAAAGCCGAAAAGGGTCCATGAATCAGCCAAAATCTCCAGCC
AAAGTCTTGAATCAAGATGACATTACTTCAGAGTTCTAGAAATTACAAATGGGTTATCAC
CATATGCAGGAGCAATTCTAGAAAGTGTAGAAGCGAGAAGAAAACGATATTTTGCGATTA
TTTGGCAAACTCACGTAACAAGCTAATAATAATCAGATATCAGAGATTGATCGAATATAA
TTGCAGTATTTTATAGAGCATCAACCTGATAAGATTAAGAGTGAGGGCTATTATTGCACA
TCCAATGGTAAAGTAAAGGGAGTGTTCACTCTTACTGAACATTTGATTATGTTTGACCCA
ATTAAATGCCAAGAAAACGAATAGTTTTAATATCAAGCAATTATCGACATCTAGGACATA
GTATCCTGCTAGAAGATCAGAACTGAGAATTAAACTGCTGAATTCATATAGGATCCAGAG
ATTAAGAAATACTATAAATATGACTATTTCATTCAAATCAATCTCTCTCAGACTGATGGA
CTCAATTTACAGCAAGTATTGAAATCAACATCGATTGACTTTGACAGAGAAGAATCAAAA
TCAATGTCAAGTTCCTCTTAGCACTCATCAGCAAACAACAATGGCTCTTCAACGTTTAAG
CAGGACTAATCTCAACGATAAGGACATGACCCCAATCATGTGCACACTACTTACCACAAA
AAGAGTATTCTACCAATCGCCATAGTGTTCTTCAGATTCAGTCACAGAGATAAGGAAAAT
GAGCCACTTACAAACAAAAAGCAGAAATTAATTGTCGACGGTATATATCAAACACTTCTA
AGATATATTGAGAAGAATTCCATATTACCAAGAAGTATAGATGGTAGTTCCTCCACATCC
GTGAAGTTTTATGATAAATTGCAGCAAGGCGATAAAGTGCCAACAAACCTTGAAGATCAC
ATGCAGAAGTAGCACTACAATAAATCCACATTTGTCATATCCGCATCATTGCCTGAGTTT
AAAACTATTATGAAAAATCAATCAGAAATTGTTGATGAAGCGAGCAGGAAACTTATTACT
TATTTCCTACCAGGGCTTATCAGAATGAGAGAATGGCGCCTATTATTTTCAATAAACCAA
GATGGAGTGTCAATGCAAACCTTCTATACTCAATTGAGAAACAGAGACAACACTCTTGTT
CTTGTCAAGGATGAAAATGATCGAGTCTTTGGTGCATACTGCTGTGAAGAGTGGAGAATT
AAGTCTGGATTCTATGGGAGAGGAGAGAGCTTCGTGTTTTACTTTGATGATGAGGAAGAT
ATCAAGGTATTTAGCTACACTGGCAAGAACGAAAGAATTCAGTACTCGGATGAAACAAGC
CTCATGATTGGAGGTGGAAACAGTGCTGCTGTTTTCATCACAGACCAATTCAAGAATGGC
AGATCAGGAAACAGTGAAACATTTGATAATGAAATTTTATCCAAGGAACCTAATTTCACC
TGCAAATAATTTGAAGTATGGGGTTTCGACTTTATTTGA


>Contig1092.1.g73(protein)
MSFLQNLNEISADSIIYPGQMLKIVNHNPANQHLLITQEQLDNQNQVQDEGDLMNSNNLN
EEVLQNLSTASPANIQVENHSDSLFNNQRKASNASDANYSTQEITIDSNDLSKNIHRAQS
QSAYAKTVDLNSRNHLTINTQKTELNKSRKGSMNQPKSPAKVLNQDDITSEFQKLQMGYH
HMQEQFQKVQKREENDILRLFGKLTQQANNNQISEIDRIQLQYFIEHQPDKIKSEGYYCT
SNGKVKGVFTLTEHLIMFDPIKCQENEQFQYQAIIDIQDIVSCQKIRTENQTAEFIQDPE
IKKYYKYDYFIQINLSQTDGLNLQQVLKSTSIDFDREESKSMSSSSQHSSANNNGSSTFK
QDQSQRQGHDPNHVHTTYHKKSILPIAIVFFRFSHRDKENEPLTNKKQKLIVDGIYQTLL
RYIEKNSILPRSIDGSSSTSVKFYDKLQQGDKVPTNLEDHMQKQHYNKSTFVISASLPEF
KTIMKNQSEIVDEASRKLITYFLPGLIRMREWRLLFSINQDGVSMQTFYTQLRNRDNTLV
LVKDENDRVFGAYCCEEWRIKSGFYGRGESFVFYFDDEEDIKVFSYTGKNERIQYSDETS
LMIGGGNSAAVFITDQFKNGRSGNSETFDNEILSKEPNFTCKQFEVWGFDFI