Identifiers and Description

Gene Model Identifier

Contig10839.0.g25

Standard Name

None

Aliases

Contig10839_0_g25

Description

Ring finger domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003130709.998397555368434e-52hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10839.0.g25(coding)
ATGGAAGAAGGAGTTTAAGCAAAGCAATAGTAAATGTTTGAGGCTTTGCAATATCCAACT
GATCTCTCTCAATTAGTTGGAACTTCAGTTTCTCTTGATTAGCCTAGATAAGCATCTAAA
ACCTGTTAAAACTTAACATAATGGATTGAGGTTTCTCCCTTGGAATTAAAATTAACAATT
GAAGATCACACCACTGTGCAACCTGCTACTGTGATAGATTATGATAAGGAAAATGAGTGC
TGCTTGTGCTTTTGCGAGCTATATGATGACTTGAAAAACTTAAGTTTGAAGGAGGTTTCC
AGGATGCAGATGGACATTATAATAAAGAAGAGTAGCAATCAAAACGCAGGAGTTGAAGTG
GTGAAAATGGGGAGATGCTAGGGCAGGCATCTCTTTCACAAAGAATGTCTGGAGAGACAA
TTGGAGAGCAGCTCAGAAAGTGCAAATAAGTTCCTTAAGTGCGCTGTTTGTGAAGTCATC
TATGGCAAGTAAGTTGGAGATATGCCAAATGGATCTATGACTTGGAAGTCTTACCCCTAT
GAGCAATCACCGTTGTAAGGATATTCAGTGTTTGACTGTCCAAATGTGATAATTATCGAT
TACTCCATCCCAAGTGGAACTTTGAGTGATGGCACACGCTATCATGGCACTAGTAGAAGA
GCTTTTCTTCCTGGAAATTAAGATGGAATCAAAGTCCTTAGTATGCTAGCAGAAGCATTT
AGAAGAAGATTGACTTTCAAAGTTGGAACTTCAATCACTACAGGATAATCGAACGTGGTA
GTGTGGCAGGGCATTCATCACAAAACCAGTCCTTCAGGTGGGACGAGCAGCTTCGGCTAC
CCTGATCCAACTTACATGACAAGAGTGACTGAAGAGTTGTCTGGTAGAGGCTTAACAATC
GATCAATTAAATGGGAAGCTGGAGTTACTTAATGGTTATATACAACTTAAGTGA


>Contig10839.0.g25(protein)
MEEGVQAKQQQMFEALQYPTDLSQLVGTSVSLDQPRQASKTCQNLTQWIEVSPLELKLTI
EDHTTVQPATVIDYDKENECCLCFCELYDDLKNLSLKEVSRMQMDIIIKKSSNQNAGVEV
VKMGRCQGRHLFHKECLERQLESSSESANKFLKCAVCEVIYGKQVGDMPNGSMTWKSYPY
EQSPLQGYSVFDCPNVIIIDYSIPSGTLSDGTRYHGTSRRAFLPGNQDGIKVLSMLAEAF
RRRLTFKVGTSITTGQSNVVVWQGIHHKTSPSGGTSSFGYPDPTYMTRVTEELSGRGLTI
DQLNGKLELLNGYIQLK