Identifiers and Description

Gene Model Identifier

Contig10748.0.g6

Standard Name

None

Aliases

Contig10748_0_g6

Description

Tctex-1 family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

  • proton-transporting two-sector ATPase complex, catalytic domain (IEA) | GO:0033178

Molecular Function

  • proton-transporting ATPase activity, rotational mechanism (IEA) | GO:0046961

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005614404.001416569413617e-37Tctex-1 family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10748.0.g6(coding)
ATGAGCAAAAAAGTAACGCAGAGTAATAAAACTTATCAAATCAGACCTCCCTTCAAGGAC
AAGTTCAGACCAGCTGAAGCAAAAGAGAAAATAGAAAAGATAGTGAGAGAAAAACTAAAG
AATGCACAATATACTTCAAACGAATTGCCACAATGGACAAGAGATATTGCAGACGAGACC
AAGCAGGAATTAAAGAATTTGGGCAAAGATAAACGCTATAAATATCTCGTGCAAGTGATT
ATTGGACAAAATAGTGGACAGGGAGTCAGAGTGGGCAGTAGATGTTTCTGGGACGAAGAC
ACAGACGATTGCACATGGGTTTCATATATGAATGATTCTATTTTTTGCCTTGTTGTTGCT
TTCGCAGTATATCTATATTGA


>Contig10748.0.g6(protein)
MSKKVTQSNKTYQIRPPFKDKFRPAEAKEKIEKIVREKLKNAQYTSNELPQWTRDIADET
KQELKNLGKDKRYKYLVQVIIGQNSGQGVRVGSRCFWDEDTDDCTWVSYMNDSIFCLVVA
FAVYLY