Identifiers and Description

Gene Model Identifier

Contig10744.0.g103

Standard Name

None

Aliases

Contig10744_0_g103

Description

Aldo/keto reductase family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003006307.996964956232603e-130oxidoreductase, aldo/keto redu
ctase family pr...
SGDYPL088W2.998577119979921e-31YPL088W SGDID:S000006009, Chr
XVI from 381965-382993, G...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10744.0.g103(coding)
ATGGTCGAAATAGCAGCAAAGCCAAAGATGATCTATAGATACTTAGGTAACTCTGGTCTT
AAGGTCTCCGCTCTCTCATTCGGAAACTGGTTGAACTCAGATGCTGATGAGAATTACGAA
ATCACAAGAGATAGCATCAAGAGATGCCTTGAATACGGAATTAACTTCTTCGACACAGCT
GAGATCTACAACAAGGGTTCAGCTGAGACTCAAATGGGAAGAGCCTTCAAAGAGCTAAAC
GTTAAGAGAGAAGATATTGTAGTCTCAACCAAGCTATGGAGAGTTGGCGATGGAGTCAAC
GATTTGTTCTTGTCAAGAAAGCACTTGCTTGAAGGAATTACCAACTCACTCAAAAGACTT
CAAATGGACTATGTTGATGTTGTCTTCTGTCACAGACCAGACTTCGAAACCCCACTTGAA
GAGACCTGCAGAGCTATGCACACCATTATCGAATCAGGCAAAGCCTTCTACTGGGGAACT
TCCATGTGGAGCGCTGATAGAATCACCAAGGCAGTTGAAATTTGCGAAAGACTTAACTTG
CACAAACCAATTACTGAACAACCAGCTTACTCAATGTTTAGAAGAGATATCGTTGAGAAA
GAATACAGAAGATTGTTCAGTGAATATAGATATGGAACCACCATCTGGTCTCCACTTGCC
GGTGGAATCCTGACTGGTAAGTACAACGACGGTAACGTTCCAGCTGGCTCTAGATACGAC
AACCACAAGGACTTCTTGAAGGGCACCTGGGAGACCCACTTTAGCGAAGCAAAGAAGGAG
TCAACCATTAAGACCTTAACAGCACTTGGTCAAATTGCTCAAGAAGTTGGCTTCACTCAA
GCTCAACTCGCTCTTGCTTGGTGCCTTGCTAACTAAGACGTGTCAACTGTTATTCTAGGA
TTCACTCGTCTTTCATAAGTTGACGAGAACATCAAGGCCCTCGAACTCTACGAGAAGTGG
GATGCTGAACTTGAGAAGAAAGTCAGAGATGTTCTTAACAACGAGCCAGAGGCCGAGATG
GACTGGAGAAAGTGGAGCCCATTAGAGCAAAGAAGATCCATTGCAGTCTCAGAGAAGAGA
AATTGA


>Contig10744.0.g103(protein)
MVEIAAKPKMIYRYLGNSGLKVSALSFGNWLNSDADENYEITRDSIKRCLEYGINFFDTA
EIYNKGSAETQMGRAFKELNVKREDIVVSTKLWRVGDGVNDLFLSRKHLLEGITNSLKRL
QMDYVDVVFCHRPDFETPLEETCRAMHTIIESGKAFYWGTSMWSADRITKAVEICERLNL
HKPITEQPAYSMFRRDIVEKEYRRLFSEYRYGTTIWSPLAGGILTGKYNDGNVPAGSRYD
NHKDFLKGTWETHFSEAKKESTIKTLTALGQIAQEVGFTQAQLALAWCLANQDVSTVILG
FTRLSQVDENIKALELYEKWDAELEKKVRDVLNNEPEAEMDWRKWSPLEQRRSIAVSEKR
N