Identifiers and Description

Gene Model Identifier

Contig10731.0.g69

Standard Name

None

Aliases

Contig10731_0_g69

Description

Oligonucleotide/oligosaccharide-binding (OB)-fold

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam07717 ) Oligonucleotide/oligosaccharide-binding (OB)-fold
  • ( pfam04408 ) Helicase associated domain (HA2)
  • ( pfam00271 ) Helicase conserved C-terminal domain
  • ( pfam00270 ) DEAD/DEAH box helicase
  • ( pfam13401 ) AAA domain
  • ( pfam13555 ) P-loop containing region of AAA domain
  • ( pfam01580 ) FtsK/SpoIIIE family
  • ( pfam00437 ) Type II/IV secretion system protein

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001209309.997093137033517e-262hypothetical protein
SGDYGL120C5.998558726299043e-153PRP43 SGDID:S000003088, Chr VI
I from 283937-281634, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10731.0.g69(coding)
ATGAAAAATTAGCCAAAGTTTTAAAACTAGCAGCACAAGTAACCAAGAAATCCTGGGGGA
GGTGAAAAGTAATCAGATAACCCTTAGTTGAAAGATGATGAGGATGGAACTGGTGCTTTC
ATGGCTTTCAGTAAAAATGACCTGTTTAAGACACTGCCTATTGAAGAAAGGGCCCTTGAA
ATCCTGTATGCCATAGAAAAGAACAACACTACGATTATAGTGGGAGAAACAGGTTCAGGT
AAATCCACGAAGCTTCCCTAGCTACTATATCAAGCTGGTTATACATAATCTAAGCACACC
CCCACACCAGACAATTAGAATTCCTCACTCTAACCTCTTAATCAAGCAACTCATAATACC
ACACCAAACAGGAAGAACTAAATGATAGGTCTGACCTTACCAAAAAGAGTGTCAGTTTTA
AACATTGCAAGTCGCCTAGCTTTGAATATGAATTCCCCTCTGGGTGATTTAGTAGGTTAT
TCTATAAGGTTTGATGCTAGATATTCGGAGGAACATACCAAAATCAAGGTTCTAACTGAT
GGAATGCTACTTAGAGAGATGCTTATTGATCCCTTGCTCAGTTCCTATTCAGTGTTGATG
ATTGATGATTGTCATGAGAGAAGTGTTTATACTGACCTCATATTGGGACTACTGAAGAAA
ATAAGAAGAAAAAGACCAAATGATTTAAAAATTATAATTTCCAGTGCCACTATAGAAGCA
TAGCTCTTTTGGAGATATTTTCAAGAACCTCCTCTATTTAAAGCTCAAGTAGTGGAAATC
GAAGGGAGGTAATATCCAGTGGAGATATTATATTTAGAACATCCTTGCAAAGATTACGTG
GCTCAAGCTGTCTAAACTGCATTAACAATACACATTAAAGAAGAACTTAATTCTGGAGAT
GTTCTTGTGTTTTTAACTGGATAAGAAGAAATAAACTAGTTTATAGAGTAATTCAATCAA
ATAGCATAAGAGAAGAAAATATCACATTCAGTGTATTGTCTGCCATGTTACGCCAACCTA
CCAATCGAAAAGCAAATGAAAATATTTGAGCCAACTCCCATCAATAAGCGAAAGATAGTG
GTGGCTACAAATATAGCAGAGACCAGCATCACAATTGAGAATATAGTATATGTCATAGAT
TCATGCTTCGTAAAAATCAAACACTACGATCCACATACAAATATGGATTCGTTGGTTATA
ATACCTGCGTCTAAGTCGGCTTGTGATTAGCGTGCTGGAAGATCTGGGAGAGTTTGCCCA
GGGAAATGTTTTAGGCTATGTACAAAAGAAGATTATGAAAATAATTTGCCATCACAGATG
AAACCAGAGATTTAAAGAACCGATACGACTCAAGTAGTCCTTCAAATGAAAGCTTTAGGA
ATCAGGAATTTGTTAAGTTTCGACTATTTAAGCCCTCCTTCAAAAGAGAATTTTATCAGA
GCTCTTGAAGTTTTATACTCCCTGGGTGCTTTGGATGATTAAGCCCAGCTTACTCAAGAT
ATTGGCTTGAAATTAGTAGAAATGCCAGTAGATCCCAGGATGGCTGCTTGTATCCTCAAT
AGCAACAGAGAAGAATGGAAAATAACAGAGGAAATACTTTCAATATGCGCTTTATTATCT
GTATAGAATCTCTTCCTGTCTGTAAAAGACCCCTACACTATATAAAAAGCAAAGAAAAAG
TGTGGAGTAATTGAGGGTGATCACATAACGCTCTTGAATATTTTTAATACATACAATGCC
AAAAAGAGTGAAGGAGAGAAGAAAGGGTTTTGCAGGGAATGCATGGTTAACGAGAAAAGT
ATCAAGAAAGCAATGTAAATCAAATAGTAGTTGAAGCAGTACTTGAGGGGTTTAGGAATA
AAACAATATAAATCAGATGATTACGATGATCCTGAAGCGATTCTAAAGTGCTTAATAACT
GGATATTTTGCGAATGTAGCACAGCGTTAAACTGATGGTACTTATAGAAATGTTCGCAGC
ATGTCAGATGTACTTGTAATCCATCCATCAAGCGTGCTATCAAATATCCGACCAAAATGG
ATATTATATCACGAAATAGTAGTTACCTCGAAGAAATTTATGCGGGAAGTAAGTGAAATA
AAAGTTGAGTGGCTTACTGAACTAGCCCCACATTTCTATGTGGACAAAAGGAAGTAAATC
ATGGAAGAATAGCACAAAAAGGAAACTATCAGAAACTTAGAACATGACTGGAATAAGAAA
GATGGACCTAATGGTCAGTAGAAAGAACTAAATGATAAATTAAACGACTAGAGCATCGCG
AAATAAATCTAAAAATAAAACAATAGATTTAGGAAAGGCATGAATTTTTCAGCTATAGAT
CAAGAATCTTAAGCTGCTACTAATAAATTGGCTATTGTCTAGAAATCCATTAAACAATAC
TAAGATCCAATAAATTCAATGAGTATAGAGGAAGTTAATGAGTCACATATTTTTATTCAT
AAGGAAGTAGATTAAATTGCTGGAAGTGATGATAAAAATATTAGTAACTCATTCAAATTT
AAGAGATAGAAGATTAGTGAAAATTAAAGTGGGAATGTGAAGAGTAAATAAAGTGGAGAG
GTAAAGCAAAGTAAGAAACCTACAGTAGGCTTAAGTTTTCAAGATGAGGAATATTGA


>Contig10731.0.g69(protein)
MKNQPKFQNQQHKQPRNPGGGEKQSDNPQLKDDEDGTGAFMAFSKNDLFKTLPIEERALE
ILYAIEKNNTTIIVGETGSGKSTKLPQLLYQAGYTQSKHTPTPDNQNSSLQPLNQATHNT
TPNRKNQMIGLTLPKRVSVLNIASRLALNMNSPLGDLVGYSIRFDARYSEEHTKIKVLTD
GMLLREMLIDPLLSSYSVLMIDDCHERSVYTDLILGLLKKIRRKRPNDLKIIISSATIEA
QLFWRYFQEPPLFKAQVVEIEGRQYPVEILYLEHPCKDYVAQAVQTALTIHIKEELNSGD
VLVFLTGQEEINQFIEQFNQIAQEKKISHSVYCLPCYANLPIEKQMKIFEPTPINKRKIV
VATNIAETSITIENIVYVIDSCFVKIKHYDPHTNMDSLVIIPASKSACDQRAGRSGRVCP
GKCFRLCTKEDYENNLPSQMKPEIQRTDTTQVVLQMKALGIRNLLSFDYLSPPSKENFIR
ALEVLYSLGALDDQAQLTQDIGLKLVEMPVDPRMAACILNSNREEWKITEEILSICALLS
VQNLFLSVKDPYTIQKAKKKCGVIEGDHITLLNIFNTYNAKKSEGEKKGFCRECMVNEKS
IKKAMQIKQQLKQYLRGLGIKQYKSDDYDDPEAILKCLITGYFANVAQRQTDGTYRNVRS
MSDVLVIHPSSVLSNIRPKWILYHEIVVTSKKFMREVSEIKVEWLTELAPHFYVDKRKQI
MEEQHKKETIRNLEHDWNKKDGPNGQQKELNDKLNDQSIAKQIQKQNNRFRKGMNFSAID
QESQAATNKLAIVQKSIKQYQDPINSMSIEEVNESHIFIHKEVDQIAGSDDKNISNSFKF
KRQKISENQSGNVKSKQSGEVKQSKKPTVGLSFQDEEY