Identifiers and Description

Gene Model Identifier

Contig10720.0.g16

Standard Name

None

Aliases

Contig10720_0_g16

Description

lactate/malate dehydrogenase, NAD binding domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

  • oxidoreductase activity (IEA) | GO:0016491
  • hydrolase activity, hydrolyzing O-glycosyl compounds (IEA) | GO:0004553
  • oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor (IEA) | GO:0016616

Biological Process

Domains

  • ( pfam00056 ) lactate/malate dehydrogenase, NAD binding domain
  • ( pfam02866 ) lactate/malate dehydrogenase, alpha/beta C-terminal domain
  • ( pfam01915 ) Glycosyl hydrolase family 3 C-terminal domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002375005.999326315775399e-131malate dehydrogenase family pr
otein
SGDYKL085W0.00000000039982266684865623MDH1 SGDID:S000001568, Chr XI
from 279123-280127, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10720.0.g16(coding)
ATGGACGATATTAGAGCAATCCAAAGACTTAAGTCACTCGGAAGACATTTCCCATAAGCT
CCCAAGGAGGATGAGAACAAGCCAATCAGAGTAGCTGTAACTGGTGCCGCAGGACAAATC
GGATCAGTCCTCTGCTTCTTCATTGCACAAGGTAGAATGTTCGGACCATACCAAAAGGTG
ATCTTGCAACTTCTAGAATTGCCATCCGCTGAGGGCCCATTAAAGGGTCTCTGCTTAGAG
CTTCAAGACGGTGCTTACCCACTCGTCGCTGAAATCAGACCATCCACTGACGCCATGGAG
GCTTTCAAGGACGCTGATGTTGCAGTGCTCGTTGGTGCCAAGCCAAGAGGCCCAGGCATG
GAAAGAAAAGATTTGTTAAATGAAAACGCTAAGATCTTCAAGGCTCAAGGTGAGGCTTTG
GACAAGGTCGCCAAGAAGAACGTCAAGGTTCTTGTAGTCGGAAATCCAGCAAACACCAAT
GCTTTGATTGCCAGCCACTACGCTCCAAGCATTCCAAAGAAGAACTTCACAGCTCTTACC
AGACTCGATCAAAACAGAGCTCTTTCTCAATTAGCTGAAAGACTACACGCCAGAGTTGAA
GACATCAAGAACGTCATCATTTGGGGAAATCACTCTCTCACTCAATACCCAGACGTCAAC
CACGCTGAAGTCTTGACTGCTGATGGAAAGAGAAAGAAGATCAGAGAAGCAGTTAATGAC
GATAAGTACTTGAATGACGCATTCTTATCTAGAGTTTAAAAGAGAGGAGGTGAGATCATT
TCAGTTATGAAGAAATCCTCTGCTGCCTCAGCCGCTTCAGCTGCATGCGATCACGTTCAC
GACTGGTGGGTAGGAACCAAGCCAGGTGAATTCGTAAGCATGGGAGTACTCAGTGACAAC
AACAAGTACGGTGTCTCCGGCAACTTGGTATACTCCTTCCCAGTGACTTGCAGAAATGGT
GAGTGGGAAGTTGTCAACGGCCTAGAAGTCGACGAATTCTCTAGAAAGAAGATGAAGGCA
ACTGAGGACGAGCTCCTAGAAGAAAGAAAGATGGCTCTTAACCAATGA


>Contig10720.0.g16(protein)
MDDIRAIQRLKSLGRHFPQAPKEDENKPIRVAVTGAAGQIGSVLCFFIAQGRMFGPYQKV
ILQLLELPSAEGPLKGLCLELQDGAYPLVAEIRPSTDAMEAFKDADVAVLVGAKPRGPGM
ERKDLLNENAKIFKAQGEALDKVAKKNVKVLVVGNPANTNALIASHYAPSIPKKNFTALT
RLDQNRALSQLAERLHARVEDIKNVIIWGNHSLTQYPDVNHAEVLTADGKRKKIREAVND
DKYLNDAFLSRVQKRGGEIISVMKKSSAASAASAACDHVHDWWVGTKPGEFVSMGVLSDN
NKYGVSGNLVYSFPVTCRNGEWEVVNGLEVDEFSRKKMKATEDELLEERKMALNQ