Identifiers and Description

Gene Model Identifier

Contig10719.0.g52

Standard Name

None

Aliases

Contig10719_0_g52

Description

Sec7 domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

  • ARF guanyl-nucleotide exchange factor activity (IEA) | GO:0005086

Biological Process

  • regulation of ARF protein signal transduction (IEA) | GO:0032012

Domains

  • ( pfam01369 ) Sec7 domain
  • ( pfam12783 ) Guanine nucleotide exchange factor in Golgi transport N-terminal
  • ( pfam09324 ) Domain of unknown function (DUF1981)
  • ( pfam04438 ) HIT zinc finger

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_008957809.997093137033517e-262Sec7 domain containing protein
SGDYDR170C9.997962730346853e-122SEC7 SGDID:S000002577, Chr IV
from 802222-796193, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10719.0.g52(coding)
ATGGAACCGGTTCGTGACCCATACGTACTCTATAGTGAGCTTTTAATTAAAGCTTTTGAG
AAAATTAATAAGCAACTTCCCAAAAAGTATAAAGAACTCAAGGATTTATGCACAGAAGCT
ATCGAAAAAGTGAAGTTGGAAAAAGAGGGACCTTATGATGCCAATAAATATTTCTACATT
TTGAAGTTGGCTCTGGATACTAAAATCGCCAAGTTAATGGAACACATTCTATACATCATT
CAGAAACTTATATCTCATGAATTCTTGGACGGAAACTGTGAAGATAATTGCATTTATCCT
GAGGATCAGAAACCCCCAGCCAATAATGGCAGACTGCCACGAAAATTGATAGATGCGATC
GTGGAATCTATTTGCAATTGCGTAACTGAGAGAGATAACTAAGTTTAACTTCAAATCATT
AAAGCTTTATTGACAGTTGTAACAACTTTCAATAGTAAAGTTCATGAGAAATCTTTGTTA
GAGGCATTCAGAGCATGTTATTAAATTCATATTACTTCAACAAATGCAATTAATCAAAAC
ACTGCTAAGGCCTCTCTTACACAGATGATTAATATGGTCTTCTCTAAGATGGAAGCTTAC
TCAGGAAGTTTTGGTATATCCCTCCCAAAGCTCTAATAAAGAAATTTGTTTGTACATCAT
AAAGGGAGCAGCTTGGACGATGGTGATCAGTCTATGAAAAATTCTGATAAGTCTTTGAAA
ATCAAGAGGTCATAGTCAATAGACGATGAAAAAGAAATCTCTATGAGGACCGAAGGATCA
AATGCTCCATCTGTAAGCTAGCCTTAAAGCCAAATAGCTGGATCATCTTAAAACAACAGC
ATTTTGATAAATTTCTCAGCTAATGATCAATACCTCTATCAAGTTGTCTAAAATATGGTG
GATGACGTTTGCCTTCATGATGCCAGATAAGAAATGATAAAAAGCAAATACATGCAACAG
CTCAATAATTTGGAAGCTAGTACAGATCTAGAAGAAAAGCAGGCTCTTGAGGAAATGATG
CAAGCTGAACTAAGCCAAATTTAACTCAGGTCAGTGCCTCAAAAAGTTTCCAAAGATGAG
GGATCAAAGACCAAGAAATAACCTTAAGTAGAAGTCAAGAATGAACATGGCATCCCAGCA
GGAAAGTTTGGTTGGTGTATTGTTTGCAGAAACTAAGCAAACCTCTACTGTAAAGATACA
AGACATCCAGTTTGCTCATTTGAATGTAAACAGAAACATGTTAACCTGATAGATTCTATC
TAAGCTCCTCAAATTGAAGGATTAAACAATTTTCATAATACAGAAGAAGCCAGAAGATAT
TTCCAAGATGCTCTTACTGTTTTCAAGAGTATATGTAAACTTTGTCTAAAAGAAATCCCT
AATCAGAGCATTAATACTTTCACTATGAGATCCAAGATTCTTGGCTTAGAGCTTATTTTA
GCAGTTGTTGAAAAGCCAGGTACTACATTTTTAAATAGGAAGGAATTCATAGATATCATC
AAAGATACTCTATGCGACGGCCTTTTGAAATATAGTGTTTCCAATGAAAAAACTATATTC
TCAACTTCATTATCAATTTTCTATTGCCTCTTTTTACATTTCAGAGAGCACTTAAAGTAG
GAGATAGTAGTATTTTTGGATTAGATTTTCTTAAGAATATTGGATTCAGGAAACTCAAAC
TATCATCATAAGTATTTGATTCTAACTGTGTTCGATAAGATAAGTCAAAATACTAAACAT
GAGCTTGAAATTTTCATTAACTATGACTGCGATTTCCAACAAAAGAATATTTTTGAAAGA
ATCATAGACTCTCTATCAAAGATAGCTCAAGGCAAATTCTAAAAGAGTGAACACTCAAAT
ATTATTACTGCTTAAGAAGAATACTCATTAAGATTATATGCTTTGTAAATCCTTGTTTAA
AATCTGAGAAATATCAACAAAACAATCGAGGCTGAAAATGCTGAATTCAAAATGGCTCAA
AGAGAAGTTTCCAGTTCAAACAAGAGAGAATCATCAGTAGACAATCATTCTGATGACGAA
GAATAAAAAGAAGATGACAAGAAATCTGCCGCATTAGATACTCTTGAGAGAGCAAGATTA
GTAAAGAACGAGATTTTAAGGGCATCAGTTAAGTTTAATTTCAAGCCTAAGAATGGTGTC
AATTATTTGATCTCAAAAAATTTGATTGCCAAAGAGCCAATGTAGCAATAAATTCTTGAT
ATAGTAAACTTCTTAAAGACTACCTCAACTCTTGACAAGACTTCAATTGGAGAGTATCTT
GGTGAGGATGTAGATCTTAATAAAAAAGTTCTATATGAGTATATCAACTAGTTTGAGTTC
GAGAATTTTCCATTTGTTGATTCTATGAAGAAAATGCTTTCTGGCTTTAGATTGCCTGGT
GAAGGCTAAAAAGTCGACAGAATTATGGAAATTTTTGGAGAAAAGTATTGCAAAGATAAT
CATGATGCATTTGGAAATGCTGAATGTATCTATGTACTTGCTTATGCTACTATGATTTTA
CAAACCAGTATTCATAATCCTTAAGCCAGTAAAACTAGAATGACTCTTGAAGACTATCTC
AAAATGACTAAAGGTATAAATAACGGCAAAGATATTGATAGAGATTTCTTAGTAGAGATA
TACACAACAGTAGAGCAAGAACCATTTACACTAGTAGAAGATGAAGAAGCGAAACTAAAA
ATTGAAGGTGCTCAAGCAAACCCAAGTAGAAAAAGAGATTTGTTCTTATAAGAAGCTAAA
GGAATGGTTAAGAGAAGTGCTGAGCAGATTAAACAAAAAACAACTAATGCTCAATTCATC
CTAGTTAATGACACTGATCCAATAAAGCCAATGTTTGGTGCAACATGGAGTGCCAATTTA
GCAGTCTTCTCAGTACTTTTAGAAGAATCAGATGATGTTAAGATTACAGAATTATGCATA
GAAGGATTTACTCATGCAATCAAAATCTCTGGATTCTATAATATGAATACAGAAAGAGAT
GCATTTGTGTCTTCTTTATCAAAGTTCACTCAAGTTTCTGCTTTAAGAGAAATTAAGGAA
AAGAATATTGAATGCATAAGAGCACTGTTAAATTTAGCCACATATGAAGGTAATTATCTT
AAGAACTCATGGTTTTATGTTCTTGATTGCATATCAAAAATTGATTATATGCATGTACTT
GGTACTGGAGCCAGAAAAGATTCAGAGTTCTTTAATGCTCAAAAGAAAGGAACTAAAAAC
GTTCAGTTACAAAGAAGACTTGAAAGAGAGCAAGCTTTGATTTAAAATTCAGAAATTATA
GTTCAAAATATTGATCTTAATCGCATTGACTTGATCATTCAAAGAAGTGTAAATTTAGAT
TCAGATGCAATCATTGATTTCATTAATAATCTATGCCTGGTTTCAAAGGAGGAGTTATCA
GATATGGATAATCCAAGAAAGTTTTCTTTACAAAGATTAGTTGAGGTTGCTGATTTTAAT
ATGGGGAGAATCAGATTTGTTTGGAGTAAAATTTGGAACGCTTTAAGTGAGCATTTCAGC
ATAGTCGGCTCTCATGCAAACTTAAATGTAGCACTTTATGCTATCGATTCTCTAAGATAA
TTAGCTGATAAGTTCTTATTAAAAGATGAATTTGGTCATTATAACTTCCAAAAAGATTTC
CTTAAGCCATTTGAAACAATTATGCTTAATAACTTACATACAAGACTTGAAATTAAAGAG
TTTATTGTTATGGCTGTTGCAAACATGTGTAGAGCAAAGGCAAAATACATAAAGTCTGGT
TGGATTATAATAATAAACATTTTCACTTTAGCCGCTTAAGATTCTGAGGAACATTTAGTT
GTTTAGAGCTTTGACGCTTTAAAATTCTCAGTCAAGACGTAATTCAGTTAGCTTGAAGAT
AACTTTGTTGAGCTTGTAAACTGCTTGAACAAATACACAAAGAATAATTTCCACAAATAG
TCATTAGAAGCCTTAGATTTACTTTTAGAATGTGCGAAAAACCTCTCACAAAGAAAAGAG
ATTATTTAGAATTTCATTAAGATTAATGGTATCAACTTCTATTAAAGAGATAGAGAAAAC
ATGCAAAGATACCCTTAACATTATGGAATTCAAAAGAGTTCACCAAGTAAAGATGAAATT
AAGTCTGCTAGATCTAACAGTGGATTTATTGCCGGAGATATCGATCAACCTGATGAACTT
AGAATCAGACACAGTGTCCAAAAAGGCTTATGGTTCCCTATTCTCACAAATTTGACAAAC
CTCATTATGGAAAAGAGAAAAGATATTTAAGATTAAGCATTCGCAGTATTGTTCAAAATC
TTAAATGACTACAATTCAGACTTTACTCTTGAGTTCTGGAAAGAAATATTAAACCAAATT
ATTTTGCCAGTTCTTGAAGATATTCATCTTGCAGTTGAAATACCAAATAAAAATACTGAC
AGTGAATTCTATAAGCAAACTATCTAAGTTTTATTGGAGAAGCTTAACGAATTCATGTTT
CAACATTTAGATACATTAAGACCACTTATTCCAGATTACATTGATGTTTTGGCCCTTTTC
ATATCAAACATTAATGAGAAGCATATCGCATCAGTTGTAATTAATCAATTCAAGCAGTTC
ATTTTGCAAGTTGGCAAAAATCTTTCTGTAAATCAGTGGAATTCTTATGTTATTTCTTTG
CAAAATTTGTTTGAAGCTACTATTCCTATTAGCCTGATTGAAGAGAAGGAGAAATTTTAG
GAGGGTCAGTAAAACTAGGATCACAGACAGTAAATGGTACCACCCAAAGGAAGATCTTCA
ATTATTTCTGACGCCTCTAGTTCAAGACAAGGAGACTTACCCTTCAATTAAGATGCTTGT
TTCACTAAATGCATAGTTCAACTTCTTTTGATAAACACTGTCTCTGAAACAGTCGAGAAA
TTCTACGACTAACTCAGTCTTCATAACTTGTACATTTTGCTAGAGTGCCTTGATAAATCC
TATAAGTTTGCCAAAGAGTTCAACCAGGAGCTTGGCCTTAGACTTAAACTCTGGAATGAG
GGTTTTATGGCTGACTTGAAACAATTGCCAGGTCTCACTGCTCAAGAGAGAGAAAGTATC
TCAACATATCTCTCTATCTTGTTTAAAATGTACTTCCAACCTAAGGATGGTCAAAACATT
GATAGCAATAGCAAGAAACTTTTCGAATTGTGCTCTAAAGTATTAAAAGACTATTGCATC
TAGCAGAGTGAATTGATAGCAATCAATAACAGTAAGTAGCAAGAAAATAGTAGACAGAAG
GTTGAGACTGAAGAAAATGAAATTCAGAATAATGATGGTGAAGGTGAAGAGAGACAATTA
TCTCTGAGTGACTTACATGAAAATGAGTTAGAAAGACAACTTCAAAACATAACACCAATA
GTTTCAAACAGCATCCTTGCCAATCTCTTGAAACTCTCAGAAGATGATTTAAAGAAGCAC
GTTAAGGATATCGGACCTCTGCTCATTGATCTATCACTTTGCAATGTTTATGAAATCAGA
GTGGCCAATAAGGAATTGCTCAGCAGAATATTTGATTATCTTATTGCAAAGATTCATTGA


>Contig10719.0.g52(protein)
MEPVRDPYVLYSELLIKAFEKINKQLPKKYKELKDLCTEAIEKVKLEKEGPYDANKYFYI
LKLALDTKIAKLMEHILYIIQKLISHEFLDGNCEDNCIYPEDQKPPANNGRLPRKLIDAI
VESICNCVTERDNQVQLQIIKALLTVVTTFNSKVHEKSLLEAFRACYQIHITSTNAINQN
TAKASLTQMINMVFSKMEAYSGSFGISLPKLQQRNLFVHHKGSSLDDGDQSMKNSDKSLK
IKRSQSIDDEKEISMRTEGSNAPSVSQPQSQIAGSSQNNSILINFSANDQYLYQVVQNMV
DDVCLHDARQEMIKSKYMQQLNNLEASTDLEEKQALEEMMQAELSQIQLRSVPQKVSKDE
GSKTKKQPQVEVKNEHGIPAGKFGWCIVCRNQANLYCKDTRHPVCSFECKQKHVNLIDSI
QAPQIEGLNNFHNTEEARRYFQDALTVFKSICKLCLKEIPNQSINTFTMRSKILGLELIL
AVVEKPGTTFLNRKEFIDIIKDTLCDGLLKYSVSNEKTIFSTSLSIFYCLFLHFREHLKQ
EIVVFLDQIFLRILDSGNSNYHHKYLILTVFDKISQNTKHELEIFINYDCDFQQKNIFER
IIDSLSKIAQGKFQKSEHSNIITAQEEYSLRLYALQILVQNLRNINKTIEAENAEFKMAQ
REVSSSNKRESSVDNHSDDEEQKEDDKKSAALDTLERARLVKNEILRASVKFNFKPKNGV
NYLISKNLIAKEPMQQQILDIVNFLKTTSTLDKTSIGEYLGEDVDLNKKVLYEYINQFEF
ENFPFVDSMKKMLSGFRLPGEGQKVDRIMEIFGEKYCKDNHDAFGNAECIYVLAYATMIL
QTSIHNPQASKTRMTLEDYLKMTKGINNGKDIDRDFLVEIYTTVEQEPFTLVEDEEAKLK
IEGAQANPSRKRDLFLQEAKGMVKRSAEQIKQKTTNAQFILVNDTDPIKPMFGATWSANL
AVFSVLLEESDDVKITELCIEGFTHAIKISGFYNMNTERDAFVSSLSKFTQVSALREIKE
KNIECIRALLNLATYEGNYLKNSWFYVLDCISKIDYMHVLGTGARKDSEFFNAQKKGTKN
VQLQRRLEREQALIQNSEIIVQNIDLNRIDLIIQRSVNLDSDAIIDFINNLCLVSKEELS
DMDNPRKFSLQRLVEVADFNMGRIRFVWSKIWNALSEHFSIVGSHANLNVALYAIDSLRQ
LADKFLLKDEFGHYNFQKDFLKPFETIMLNNLHTRLEIKEFIVMAVANMCRAKAKYIKSG
WIIIINIFTLAAQDSEEHLVVQSFDALKFSVKTQFSQLEDNFVELVNCLNKYTKNNFHKQ
SLEALDLLLECAKNLSQRKEIIQNFIKINGINFYQRDRENMQRYPQHYGIQKSSPSKDEI
KSARSNSGFIAGDIDQPDELRIRHSVQKGLWFPILTNLTNLIMEKRKDIQDQAFAVLFKI
LNDYNSDFTLEFWKEILNQIILPVLEDIHLAVEIPNKNTDSEFYKQTIQVLLEKLNEFMF
QHLDTLRPLIPDYIDVLALFISNINEKHIASVVINQFKQFILQVGKNLSVNQWNSYVISL
QNLFEATIPISLIEEKEKFQEGQQNQDHRQQMVPPKGRSSIISDASSSRQGDLPFNQDAC
FTKCIVQLLLINTVSETVEKFYDQLSLHNLYILLECLDKSYKFAKEFNQELGLRLKLWNE
GFMADLKQLPGLTAQERESISTYLSILFKMYFQPKDGQNIDSNSKKLFELCSKVLKDYCI
QQSELIAINNSKQQENSRQKVETEENEIQNNDGEGEERQLSLSDLHENELERQLQNITPI
VSNSILANLLKLSEDDLKKHVKDIGPLLIDLSLCNVYEIRVANKELLSRIFDYLIAKIH