Identifiers and Description

Gene Model Identifier

Contig10658.0.g47

Standard Name

TAF6

Aliases

Contig10658_0_g47

Description

TATA box binding protein associated factor (TAF)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • DNA-templated transcription, initiation (IEA) | GO:0006352
  • regulation of DNA binding transcription factor activity (IEA) | GO:0051090

Domains

  • ( pfam02969 ) TATA box binding protein associated factor (TAF)
  • ( pfam07571 ) Protein of unknown function (DUF1546)
  • ( pfam02291 ) Transcription initiation factor IID, 31kD subunit
  • ( pfam03847 ) Transcription initiation factor TFIID subunit A
  • ( pfam00808 ) Histone-like transcription factor (CBF/NF-Y) and archaeal histone
  • ( pfam11827 ) Protein of unknown function (DUF3347)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYGL112C0.00000000002000577768187062TAF6 SGDID:S000003080, Chr VII
from 299728-298178, Geno...
T. thermophilaTTHERM_007873600.000019995566179747357TATA box binding protein assoc
iated factor

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10658.0.g47(coding)
ATGTCAATTTTGCAAGATAAAGATTTAATTAGTTCTTTCGCAGAGAGCGTGGGAATAAAA
AAACTCGAAAAAGAAGTCGAGGATTTAATTCTATCAGACTTAGAAAGCAAAGTTCTTGAG
ATATTACAAGAATCTAAGAAAATAATGAGACATTCCAAGAGAGATTATCTGAAGACTGAT
GATGTCAAGCTATCTATGGAAAAGTTATCAATTCCTAATATGTTTGGATATCCATCTACT
GTACCCTATACCTATGAAAGAGTCCCTGATTAACAAAACCTCTGGTTTGTAAAGAGTTAG
AATATAAACTTGAAGGAACTTGCTATTGATCACAAACTACACACTCCTCTAGACTCAACA
ACCTATAAAATTTACATTTAAGCACTAGACGGAAACCAACCTAAAATTGCAGAGACTATC
GAAGAAAGAGAAATACCTGCATATATGCAGTAATAATAGAGAATTGCTGAATAAGTAGAC
TAAAACATAATAAGAGTCGATCCCCAAGAAGAGTTTAAGAAAGAAGAAGAAAGAAAAGAG
CAGTAGAGACTATAGTCTCTCGAGAGATCCAAGCAACATTTCGAGCAGAGACAAGCCCAA
ACTCAGCAGCCAACTAAGGAATTAAATGCTTAATACTTGATGTTCATAGAGTAGTATCAG
AAACTAGATAAAAGTCTGATTACAGGGGATCAACATGAGCAGGCTGAAAATGACCTCAAA
ATGAAAGTTTAGCTCAAATAGATGGAAGAGACTCCGGCTTTGTGCAGTATATTCCCTAAT
TTGGCTAAGTTCATTGAGGAGAAAAATAGACAAATCGTGCAAAATATTGATATTGAGAAG
AAATCATTCACTAAGAGTCAGGCATTACTCTTGCAGATAATCTAGAGCATGATAAAAAAT
AATTACTTTGGAATTGAGACAATCGTGGTAGAACTTTTGAAAGTAGTGACAGCAATAATA
TTTAGAGACATCCCAGACACCATTGCTTACAACGAAGATGAAGTACTTGAATTGAAGGAT
AACGCCGCTTTCGTCATGCACGATTTATATGTTAAGACTAAGGGCAAGCTACCTGACCTC
AAAACATAATTGGTCAATTTATGTTTGAGCAGATTATTCAGAGAGCAAATCAATCAAATG
AGCCAGTAAAATCAGGCTACCGTAGAAGTAAGCGGGTTGATAATATATGGAGCTTTAACC
TCTCTGAGAACTTTCGGTGCCGTTATTACAAGATAAGCTTTAATTCCAAACTTGATAAAT
TTATCCGTGTTGCTCCGCAAAAAGTCAGAAATTTACAATGGCGCTAACAGCAGACAAATA
TATGCCATCCAAAAGGCTTTCGAGGTTTTAAAGAACGAATGTATATTGATTGTGCAGTAT
TTGAGAACTCATGATAAAACTAACGAGGAGGGACTCAAGAAAATTATTCAAGATATCAAT
ATGGTGTTTGGTCAGTAGCTGGACCAGTTGATTTAATGA


>Contig10658.0.g47(protein)
MSILQDKDLISSFAESVGIKKLEKEVEDLILSDLESKVLEILQESKKIMRHSKRDYLKTD
DVKLSMEKLSIPNMFGYPSTVPYTYERVPDQQNLWFVKSQNINLKELAIDHKLHTPLDST
TYKIYIQALDGNQPKIAETIEEREIPAYMQQQQRIAEQVDQNIIRVDPQEEFKKEEERKE
QQRLQSLERSKQHFEQRQAQTQQPTKELNAQYLMFIEQYQKLDKSLITGDQHEQAENDLK
MKVQLKQMEETPALCSIFPNLAKFIEEKNRQIVQNIDIEKKSFTKSQALLLQIIQSMIKN
NYFGIETIVVELLKVVTAIIFRDIPDTIAYNEDEVLELKDNAAFVMHDLYVKTKGKLPDL
KTQLVNLCLSRLFREQINQMSQQNQATVEVSGLIIYGALTSLRTFGAVITRQALIPNLIN
LSVLLRKKSEIYNGANSRQIYAIQKAFEVLKNECILIVQYLRTHDKTNEEGLKKIIQDIN
MVFGQQLDQLIQ