Identifiers and Description

Gene Model Identifier

Contig10574.0.g67

Standard Name

None

Aliases

Contig10574_0_g67

Description

Hsp70 protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam00012 ) Hsp70 protein
  • ( pfam06723 ) MreB/Mbl protein
  • ( pfam01968 ) Hydantoinase/oxoprolinase
  • ( pfam08841 ) Diol dehydratase reactivase ATPase-like domain
  • ( pfam14450 ) Cell division protein FtsA
  • ( pfam02782 ) FGGY family of carbohydrate kinases, C-terminal domain
  • ( pfam06050 ) 2-hydroxyglutaryl-CoA dehydratase, D-component
  • ( pfam04518 ) Effector from type III secretion system
  • ( pfam05103 ) DivIVA protein

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001718509.997093137033517e-262dnak protein BiP
SGDYER103W9.997093137033517e-262SSA4 SGDID:S000000905, Chr V f
rom 364589-366517, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10574.0.g67(coding)
ATGAAAAGAACGTGTTTGAATCAAATCATTCTAATATCTTTGTTAGCCCTCGCATTCATT
TGCGGACCCTCAAAGAAGAAGGAAGTTGAAGGACCAGTTATTGGTATCGATCTCGGTACA
ACCTACTCTTGCGTGGGTATCTTTAAGAATGGAAGAGTCGAGATTATTCCAAATGAATTT
GGAAACAGAATTACCCCCTCATTCGTCGCATGGTCAGACGAAGAGAGACTAGTCGGTGAA
GCCGCTAAGAATCAAGCCCACTTGAACCCCAGAAGATCAGTATATGTCGTTAAGAGACTT
ATTGGTAGAGCATACGACGACAAGGAAGTCCAAAGGGACAAGAAATTCTTGCCCTACGAA
ATCGTAAACAAGGGTGGCAAACCATACATTAAAGTGCAAGTATAAGGAGGTGAAGAAAGA
ACCCTCTCCCCAGAGGAAGTTTCAGCTATGATTCTCATCAAGATGAAGGAGATTGCTGAA
GCCTATCTCGGTAGAGACGTTAAGCATGCAGTTATCACTGTCCCAGCATATTTCAATGAT
TCACAAAGACAAGCAACCAAGGATGCCGGTTTGATCGCTGGTCTCGATGTTTTGAGAATC
ATCAATGAGCCAACTGCTGCAGCTATTGCCTATGGTATGGACAAGAAGCAAGGAGAGAAG
AACATTATCGTCTTCGATCTTGGTGGAGGTACTTTCGATGTCTCCCTTCTTACTATTGAT
AATGGAGTTTTCGAGGTCGTCGCTACTAGCGGTGATACCCATTTGGGAGGTGAAGATTTC
GATCAAAGACTTACTGAACACTTCATTAAGATTTTCAAGAAGAAGAACAATAAAGATATC
AAGGACGACCCAAGAGCCTTCTAGAAGTTAAGAGCTGAAGTTGAAAAGGCCAAGAGAGAT
CTTTCAAGTGTCCATCAAACCAAGGTTTCAATTGAGAACCTTATGGACGGTATTGATCTC
AGCGAGACCATTACCAGAGCTAGATTCGAAGAATTATGCAATGATTTGTTCAAGAAGACT
CTTTAACCAGTTCAATAAGTCCTCGACGATGCAGGTATGAAGAAAACCGATATTGATGAA
GTCGTACTCGTTGGTGGTTCAACTAGAATCCCCAAGGTTCAACAATTAATCAAGGATTTC
TTCAACGGAAAGGAACCAAACAGAGGTATTAACCCAGATGAAGCCGTCGCCTACGGAGCT
GCAGTTCAAGGTGGTATTTTAGGAGGTGAAACTTCAGAAGAGACTAAGGATATTCTTTTG
ATCGATGTAACCCCACTTACCCTCGGTATTGAGACTGTTGGAGGTGTCATGACCAAGATC
ATCAACAGAGGTACCGTCATCCCAGGAAAGAAGTCTCAAACCTTCACCACCTATCAAGAC
CAACAAACAACTGTCACCATTTAAGTCTTCGAAGGTGAAAGAACCATGACCAAGGATAAC
CATTTGTTAGGTAAATTCGATCTCACTGGTATCCCACCCGCCCCAAGAGGAGTTCCCCAA
ATTGAAGTCACTTTCGAAATCGATGAAAACTCCATATTGAGTGTCACTGCTCACGAAAAG
GGCACTGGCAAGGTGGAGAGTATCACAATTACCAATGACAAAGGTAGACTCAGCAAAGAG
GAAATCGATGCCATGATTAGAGATGCAGAGAAGTTTGCCGATCAAGACAAGGAACTAAAG
GAAAAGATTGACGCCAAGAACTCACTTGAAAACTACATTTACACAATGAGAAACACAATT
GAAGATAAAGAAAAGTTGGCAGAGAAGATCGAATCAGATGATAAGTCAAAGATCAAGGAC
GCTCTTCAAGAGGCCCAAGACTGGTTAAGCTCTCACGATGAAGCTGAAAAGGACGATTAT
GATAGCCAACTCAAGGATTTACAAAGCATCTGCGATCCAATTATTTCCAAGGTATACAAA
CAACAAGGTGGCCAAGGAGCCCCAGGAGATGATGAAGATCACGAAGATCTATGA


>Contig10574.0.g67(protein)
MKRTCLNQIILISLLALAFICGPSKKKEVEGPVIGIDLGTTYSCVGIFKNGRVEIIPNEF
GNRITPSFVAWSDEERLVGEAAKNQAHLNPRRSVYVVKRLIGRAYDDKEVQRDKKFLPYE
IVNKGGKPYIKVQVQGGEERTLSPEEVSAMILIKMKEIAEAYLGRDVKHAVITVPAYFND
SQRQATKDAGLIAGLDVLRIINEPTAAAIAYGMDKKQGEKNIIVFDLGGGTFDVSLLTID
NGVFEVVATSGDTHLGGEDFDQRLTEHFIKIFKKKNNKDIKDDPRAFQKLRAEVEKAKRD
LSSVHQTKVSIENLMDGIDLSETITRARFEELCNDLFKKTLQPVQQVLDDAGMKKTDIDE
VVLVGGSTRIPKVQQLIKDFFNGKEPNRGINPDEAVAYGAAVQGGILGGETSEETKDILL
IDVTPLTLGIETVGGVMTKIINRGTVIPGKKSQTFTTYQDQQTTVTIQVFEGERTMTKDN
HLLGKFDLTGIPPAPRGVPQIEVTFEIDENSILSVTAHEKGTGKVESITITNDKGRLSKE
EIDAMIRDAEKFADQDKELKEKIDAKNSLENYIYTMRNTIEDKEKLAEKIESDDKSKIKD
ALQEAQDWLSSHDEAEKDDYDSQLKDLQSICDPIISKVYKQQGGQGAPGDDEDHEDL