Identifiers and Description

Gene Model Identifier

Contig10468.0.g95

Standard Name

None

Aliases

Contig10468_0_g95

Description

NAD binding domain of 6-phosphogluconate dehydrogenase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam03446 ) NAD binding domain of 6-phosphogluconate dehydrogenase
  • ( pfam02826 ) D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
  • ( pfam03807 ) NADP oxidoreductase coenzyme F420-dependent
  • ( pfam01488 ) Shikimate / quinate 5-dehydrogenase
  • ( pfam07991 ) Acetohydroxy acid isomeroreductase, catalytic domain
  • ( pfam02737 ) 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
  • ( pfam02558 ) Ketopantoate reductase PanE/ApbA

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003104003.000328303707556e-126NAD binding domain of 6-phosph
ogluconate dehy...
SGDYGR256W0.000000000010004361180063202GND2 SGDID:S000003488, Chr VII
from 1004624-1006102, Ge...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10468.0.g95(coding)
ATGGAAAAAGCTGCAATTAAAATCGGTTGGATTGGCACAGGAGTTATGGGAAAATCCATG
TGCGGTCATTTAATGAAGAGTGGCTACAATCTTTCAATATATACCAGAACAGCTAGCAAG
GCCGACGACCTAATTCAAAATGGTGCTTAATTCAAGGAACCAAAGGAGCTTGCTCAAACT
TCTGATGTTCTCTTCTTAATGTTAGGCTATCCTCATGACGTCGAGCAGGTCGTGTTAGAT
GAGAAAAATGGAATCTTGCAACACATGAAAGAAGGAGCCGTGCTTATTGATCATACCACC
AGCAGTCCAGGACTTGCATTGAGAATATACGAAGCTGCAAAGTAGAGAGGCGTCAAATCA
ATTGACGCTCCAGTTAGTGGTGGAGATATCGGTGCTAGAAACGGAACATTAGTAACCATG
GTAGGAGGAGATAAGGAAGTCGTTGATCAATCTTATGACATCCTAAAAACCTACTCAGCT
GAAGTTTAACATATGGGCGATGGTGGTGCTGGTCAACACACTAAGATGGCTAATCAAATT
ATGATTGCTAATACAATGGTAGGCACCTGCGAAGCTCTCATCTACGGACACAAGGCTGGT
TTAGACCTTCATCAAATGATCTTGCTCTTAAATAAGGGAGCAGCTGGAAGCTTTTCTCTT
GATAAGCTAGCTCCAAGAATGCTTAGAAGAGATTTTGAACCAGGTTTCTACGTGGAGCAT
TTCATCAAGGATCTTGGCATCGCACTTGAGGAAGCCAGAAGAATGAAACTTGGACTACCA
GGTCTTGCTCTTGCAAGCTAACTCTATCAAGCACTCGGAGCTCAAGGCTTTGAAAGAAAG
GGAACCTAAGCTTTGCTTTTAGCCTTAGAACAACTTAATGGCACTCAAATCAGAAAGTAC
GACATTTGA


>Contig10468.0.g95(protein)
MEKAAIKIGWIGTGVMGKSMCGHLMKSGYNLSIYTRTASKADDLIQNGAQFKEPKELAQT
SDVLFLMLGYPHDVEQVVLDEKNGILQHMKEGAVLIDHTTSSPGLALRIYEAAKQRGVKS
IDAPVSGGDIGARNGTLVTMVGGDKEVVDQSYDILKTYSAEVQHMGDGGAGQHTKMANQI
MIANTMVGTCEALIYGHKAGLDLHQMILLLNKGAAGSFSLDKLAPRMLRRDFEPGFYVEH
FIKDLGIALEEARRMKLGLPGLALASQLYQALGAQGFERKGTQALLLALEQLNGTQIRKY
DI