Identifiers and Description

Gene Model Identifier

Contig10454.0.g12

Standard Name

None

Aliases

Contig10454_0_g12

Description

EAP30/Vps36 family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam04157 ) EAP30/Vps36 family
  • ( pfam13075 ) Protein of unknown function (DUF3939)
  • ( pfam11977 ) Zc3h12a-like Ribonuclease NYN domain
  • ( pfam04339 ) Protein of unknown function, DUF482
  • ( pfam13907 ) Domain of unknown function (DUF4208)
  • ( pfam12889 ) Protein of unknown function (DUF3829)
  • ( pfam06815 ) Reverse transcriptase connection domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYPL002C6.002718307283067e-26SNF8 SGDID:S000005923, Chr XVI
from 554328-553627, Geno...
T. thermophilaTTHERM_004490901.0002869940498747e-21hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10454.0.g12(coding)
ATGAGAAGAGGAATAGGTGTAGCAGGAGTGCAGTAAAACAAATTAGTATAGTAAAAATTG
AAAGAAGTTGGTCAGTAGATTGAAGAGACTTAATTTTAGGAAATGAATAAATAACTTACT
GAGTTTAAGAGCCATCTTGAAACTTTCGCTATTAAGCACAGAAAAGAAATCAATTAAAAC
CCAGTGTTCAGAAATCAGTTCCTTAAAATGTGCAAAGAAATCGGTGTTGATCCACTGAGC
TCAAACAAAGGATTTTGGGTGGATAAGCTTGGAGTTGGAGACTTCTATTATGAACTTGCT
ATATAAATTGTGAATATATGCATAGCCTTAAGAAAAAAGAATGGTGGCTTTTTGGAAGAA
ACTGAATGCTTAGAACTATTAAAAAAGATTAGAAGTTCAAAATCTGAAGAAGTTACACTT
AAAGACTTAAGAAGAGCAGTTGACAGCTTGCACAAGCTGGGTTCAGAATTCAAAATTATC
CACACAGGTACTAAGAGAGTGATATGCTCCACTTCAGTAGAACTCTCACAAGATAATCTG
ATGATCTTACAAGCTGCTGAATAGAATCAAGGGTGGATTACTTACACTAAGATGCATCAA
GTGAATCCTAGTTTTTACAACTAGCTTGACAGATTCTAGAGAGCCATTGATTAGCTTATC
AAAGAGGGTCTGTGTTGGGTAGATGAGCAACCTTTGCTTGATGGACAATCTTCGAAGGGA
GTTTATGCTAATTATAGAATGGATTAAGACTAGGGGAAGTGCTATTGGTTCCCAACTCTA
ATGGCTCATTAAGAAAAGATGAATAAGGAAATAGGTGAAGATTTAAGTCTTATCAATAAA
TTCAATTGA


>Contig10454.0.g12(protein)
MRRGIGVAGVQQNKLVQQKLKEVGQQIEETQFQEMNKQLTEFKSHLETFAIKHRKEINQN
PVFRNQFLKMCKEIGVDPLSSNKGFWVDKLGVGDFYYELAIQIVNICIALRKKNGGFLEE
TECLELLKKIRSSKSEEVTLKDLRRAVDSLHKLGSEFKIIHTGTKRVICSTSVELSQDNL
MILQAAEQNQGWITYTKMHQVNPSFYNQLDRFQRAIDQLIKEGLCWVDEQPLLDGQSSKG
VYANYRMDQDQGKCYWFPTLMAHQEKMNKEIGEDLSLINKFN