Identifiers and Description

Gene Model Identifier

Contig10401.0.g79

Standard Name

None

Aliases

Contig10401_0_g79

Description

Partial alpha/beta-hydrolase lipase region

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam04083 ) Partial alpha/beta-hydrolase lipase region
  • ( pfam00561 ) alpha/beta hydrolase fold
  • ( pfam12697 ) Alpha/beta hydrolase family
  • ( pfam12695 ) Alpha/beta hydrolase family
  • ( pfam05057 ) Putative serine esterase (DUF676)
  • ( pfam00326 ) Prolyl oligopeptidase family
  • ( pfam02450 ) Lecithin:cholesterol acyltransferase
  • ( pfam06028 ) Alpha/beta hydrolase of unknown function (DUF915)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000137202.0000012618802033e-84ab-hydrolase associated lipase
region family ...
SGDYKL140W7.998932288246191e-33TGL1 SGDID:S000001623, Chr XI
from 180779-182425, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10401.0.g79(coding)
ATGAATAGAACATCTCCCAGGATCCTAACAGTGCTAGCTTTAGTTGCTGTTTCATCAGCA
GTGCTAGCATCATAGCCTGATCATCATCACCACAGTCATCATAAGGACGATTAATCAATA
GGGCACATCCACCATAATGCCTCAGTATATGAAATGTCTACAATCGTGAACTCAGACGAG
AGCACAAAGCCATCTGATGTGTCTGCTGATCCAGATCTATATCTATCCTTTGAGCAAATC
GTCAAAGAAAATGGATTCCAGTATGAAGAACATACTGTAACAACCAAAGATGGGTACATC
CTAAAAATCTTCAGAATTCCAGGTAGAACTACAGAGGCAACTACTAATGGTAAAAAAGTT
GCACTACTTCAACATGGCATTTTGGATTCCGCTGACTGCTGGATCTCTCACAGAGCTAAT
GTTGCACCTGCATTCCAAGTAGTTAGAGCTGGATATGATGTTTGGCTTGGCAATTCAAGA
GGAAACAAGTATTCTCACTCCCACAGAAACCCTTCAATCAGCAACAAGGACTACTGGTCT
TTCTCCTTCGCTGATATGGGAACTGGAGATCTTCCAGCAGTAATTACCTACATCAAGGCA
GTCACTGGTCAAGATAAGCTTGCTTTTATTGGACACTCTTAAGGCACAACTCAGATGTAC
TATGCTCTGGCTAAGAACGAAGATTTTTATGCTAACTCTATTAGTGTGTTTGTTGCTTTA
GGTCCAGTTATGAAGCTCACTAATTCCAAGTCTAACTTGCTGTAATTAATTGCTCATAAT
GATGCACTTTTACTTGCAACCTGCCAAACACTTGGAATCTATGAATTCTTCCCAGCTAAC
TGGCTCACAACTGGTGCCATGAGACTTCTCTGTGGTACTCTTCCAAGTCTATGCCAACTA
GGAGATTACTTGATTGCTGACGAAGACCTCTCTTTGGACGATAAAGACAGATTAACTGTT
TATTTTGGACACTTCCCATCAGGAACTAGTTTGTACTGCCTTGATCACTACTCACAAATC
TTGAAAGCTGATAGATTCCAAGAATTCGACTATGGTAAATCAGAGAACAAAAAGAGATAC
AACTCTCCTACTCCCCCTGAAATTAACATTTAAGGAATCTCAAAGGTCCCAATCGCTATG
TTTGTTGGAACTAAAGATGAACTCGCAGATTCAGCTGACAACCTCTGGGCAAAAACCTAA
CTTAAGACCTTAGCTTTCTATCAAGAATACGCATTGGGCCATCTCACTTTTATGATTGGA
AATGACATGTCATACTTCAATGACGTCTTGAACATTCTCCAAAAGTATCACCCCTCATCA
TCTTCATTCATTCAATGA


>Contig10401.0.g79(protein)
MNRTSPRILTVLALVAVSSAVLASQPDHHHHSHHKDDQSIGHIHHNASVYEMSTIVNSDE
STKPSDVSADPDLYLSFEQIVKENGFQYEEHTVTTKDGYILKIFRIPGRTTEATTNGKKV
ALLQHGILDSADCWISHRANVAPAFQVVRAGYDVWLGNSRGNKYSHSHRNPSISNKDYWS
FSFADMGTGDLPAVITYIKAVTGQDKLAFIGHSQGTTQMYYALAKNEDFYANSISVFVAL
GPVMKLTNSKSNLLQLIAHNDALLLATCQTLGIYEFFPANWLTTGAMRLLCGTLPSLCQL
GDYLIADEDLSLDDKDRLTVYFGHFPSGTSLYCLDHYSQILKADRFQEFDYGKSENKKRY
NSPTPPEINIQGISKVPIAMFVGTKDELADSADNLWAKTQLKTLAFYQEYALGHLTFMIG
NDMSYFNDVLNILQKYHPSSSSFIQ