Identifiers and Description

Gene Model Identifier

Contig1040.1.g122

Standard Name

LSF1s

Aliases

Contig1040_1_g122

Description

Protein of unknown function (DUF3659)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam12396 ) Protein of unknown function (DUF3659)
  • ( pfam03302 ) Giardia variant-specific surface protein

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001407907.998336109808381e-38conserved hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1040.1.g122(coding)
ATGCAAACATATTTTAATAAACAAACACGAATGCTATTTATTGCTTTGACTTTAATAATT
ATGCTCTCTTAGTAATTTGCAAATGCATAGGTTTAATTCAGGACCATTTCAGGCAGTCCA
ACTCCTTAAACAGTAGGAGCCTAATCAGTGCTGTAATTTCTTAGTTTGCTACCCACTGGC
AATAATTATGCAACTGGAGATACACTCGTTTACACTGTGCCTTCCCCTGGCTCATTCACA
CCCTCCACCAGTGTCTCACTCTGTCAATCTTAAACGAGTGGAATCGTTGTAACTTCTTGC
ACAATCACGGCTAACATTGTTACTTTAACTATATCAACAACTGGTACTCTTACCACTTTT
ATAGTAAATGTTTAAAATTTCAAAAATCCTCCTTCAACTCAAACTATTACTGGATTCTCT
GTCACTCTTTCAAATGCTACAGCCACTAAAGCAACATTGAGTGGAGGAGTAATATAAAAT
TTTAGACCTGACTCTTTAAATGCAGCTGCAATAACTCCCAATTCTTCAAAAATTGGAGAT
TCTTAAAGCGCATTGACAATTAGCTTAACTCCAAAGAACAATCTTAATACTGATGGCAGG
ATCTATGTTGAATTTCCCATTTACAACCCATAGTCTTCACAAGAGGATCACATGATGCAG
CAAGAAACACCTACTTGCACTGGAATTACAAACATGAAAAGTTCAATAACTTGCAGTTAT
GATAAAGTTAGAAGGAGGTTAACATTGACAAGCATGATAGACAATAATGTTTCTGGAGGA
TCTACAGCTTTAACTTTTTAAGTGGATAGTTTTATGAATCCTTACTCTGGTATTCCTAAG
ACAGGCTTCTATATATCAACGGCAGATTCAAATGGTAATCAAGTCGATATCTCGTCCAGT
TTGTCAGTAACTTCTACAGAATGGGCAGAATTTTTGAGTGCTTCATTTGAGAGAAAAGAT
ACAGTTACAACTGTCAATGAGCTTTCAACTGGGCTTGTGATATTTGATTTGAATCTTCAT
TTGGAGATAAATTGCAGGTTGAGAATAGATTTCCCCACGGATCAACCATTAACTAGTGAT
CTTACTTCAATTTTTGGTGCAAACATATTTTAGAATGGTTAAATTAGAACACTTAACATT
GCAGGAAATTATATGGAGATAGATGGCTGCTAAAGTCCTTCAGTTCCTACTTCCAAAGCA
TATATAGAGTTAAATTAGATTCTTAACGCAAACTAAGTAAAAGAGACCTAATCTTTTTAA
TTTTCACTCTTCGCTGTATCTAACTCGCAAACTTATCGCATTGCTAAATAATCTATTGAT
CTTAAGATTGAAAGTACATAACTAACTCCTGGAGGCATCACTTCTTTGAAAGTTGAAGCT
GTAGATTCTAAGGTCATTTAGACAACCACTCGTTTTAAGGTAACTATCTTGCCCGAACAT
TCTATTCCTACTACATCTAAAATCATAGTAAAATTCCCAACTTCTATAACTCTCACAGAC
TAAACAGCTTGCACACTTTCTAGTGTCAGTGGGGGTATTTCATCAAGTCCAGGAAGTTGT
GTGGTGAGTAGCAATACTATAACAATAACAAATCCATTTGGAACGGGATCTTATACTAAA
AATGGTTCAGCTCTTTCATTCATTTTTAGTGTGGGAGGTACTAACCCTATATCTGTTAAA
GATGCGGGTTAATTTGAAATTCTAACTGAATCTTTAGTAGACACAACATACTATACCATA
GATGCAGGTGTTTTTAGTAGTATCTACCTACCTGATCCCTTCATTTTAGCTGCCTCTGTC
ACTTCCGTATCATCTTACTAGACCTACTTCTCTCCTGCCTCATATACTATCGATATCAAT
CCTAATAAGGTGATTCCTATTGGTGGCCTTATTAATGTTAAATTTCCATAATAAATATCC
CTATTAAATACTGGCATCGGTCTGACCTCTTGTTAGCTAAAGATAGGATCAGTTCTTACA
TCCCTTTCACAGTGTGTAATCTCTTCAACCAGTCCGGTAACAGTAAGCATTAAGGATGCA
TTCTCATCAACAGCCTATACTTCAACAGGGACAGCATTTGAATTGATACTTGGAGGACTG
ATAAATCCAAGAACAACATCCACAACCGACAGCTTCTCGATATCAACCACTGATTCGAGT
AGTTACGCAATTGAATCACTTTCAACAGGCATCACAGTCAAAATGAATTCAACTCCTGAT
ATCTCAGAATTCAAAGCAACTCCATCTAGTTTGATAACTGGCAATAAAGCAACCTACTTA
TTCTAGGTTAAGACTGGTATTCCAATTTTATCTACTGATTCAATTACATTTAAATTTCCA
GATGAATTAACACTTCCATCGCCCCTGATCTGTACCGGTGTAACATTGATCACCACAGTG
ACTTGTACCTTAACATCAACAAACACTATCAAAGCAACTTTCACCCAAGTTTCTAGTGGA
GTAATAGCTGCAAATACTGAGTTTGCATTTAATATTGCAAACATAGACAATCCATCCAGT
ACTAAACCTACTACAGCATTTTCTGGCATAATTATGAACGATGCAAATGGAGTTTAAATT
ACTTAATACACTGGCAGTAGTGTTTCAGTTTCGATGACTACTCCTGCAACTGTATTAACA
AAAAGCATAACATAGGACAGCTTTGCACTTTCTACAAATACACTTTATACACTAACCTAC
ACAACTGTTAATTCGATGGCTAGCTAAGCAGGATTTCTGATAAATTATCCATCAACAGTA
TCTTTAACTTCTTTATCAACCTGCAAAATTACACATTTGACAATTCAATACGCGATGAGT
TGTTAACTTACAACAAGCACTCGATTAATTAAGTTGAGCAGTGGACTTACTGTGCCTGTG
ACAAAAGGAGATTAGATACAGATTTAACTTGGTGATATCAAGAACCCAGCATCTTAACAA
GCCAATGAATCATTTTCTCTCACGTCTTATACTGACTCTACTTTTTAATATGCTTATGAT
AACATCCCTAATGGTTTAGTTCCACAATTTGAGTGTAATTATCCTTGTGCTACTTGTCCT
TCAGGAGACAAGAGCAAATGCTTATCTTGCATTACAAATGTAGCCGGTGAGATATACACT
TACTTATCTGGCACCACTTGTTTGGCGTCATGCCCAGATGGAACTTACTCTGACAGCAAC
ATGATTTGTTAATAATGCCCCTCAGAATGCAAAACATGCTCAAATTCTTCAACTTGTACT
TCCTGTGATACTACAACAATTTACGCTTACTTGCTTGAGGGTTGGTGCTACACATCTTGC
CCTAATGGAATGTGCTCTGATAAATTCAGTTGCGTGTTTTGCACTCTTGACCAGTTTAGA
AATGTCATAGTGACTCCTACTACTAAAACTGTGAGCACTCAAAACAATACAGTTTCATTC
AATGCTCTTCTTCCAACTGGAAAGACTTACACAAATGGAGCCATTATTACCTATACCATT
CCAAGCCCAGCTTCTTTTACCCCATCAACTACTGCATCATTTTGTACATCATTAACAACA
GGAATAAACATTTAATCTTGTGTGATAATGGCAAACTCAGTAGCAGTCAAGATTTAAGCT
AATGTAGAAACACTAACTTCTTTCACTATCAGAATTGGGAATTTCAATAACCCACCATCA
TCATGTGATGTTAATGGAATCTCAGTGAGGATGGTAAACAGCGTTGGTGATTCTGTGGCT
GAATACTCAAGCGCAACTCTCTCTGGTTTAGTTCCAGCAAAGATAACAACTGTCTCATTG
ACTTCTTCATCTACAAAAGTAGCCACTACTGGTAACACTCTTGCAGTATCATTCAACGTG
GTGACAACTCTGACTACTAGCAGCTATATTCAATTACAATTACCTTATTGGAATCCAGAT
TCAACCACACCACAGCATTTCATTGAGAGTCCTAACCCTACTTGTATAGGATCTTCACCT
CTCAGGTCATCTATAAGCTGCACTTATACTTTAGACAGTTTGAGAAAGCTGAGTGCGAGA
ACAATAATGGATGTGGCTAGTGTATCTAGTGGTGTTAGTGTAGGCTTTACAATTAGTGAT
TTTGTCAATCCTTACTCAACTGCCCCGAAAAGTGGATTTCAAATTACTACATATGATATA
AATGGATGTTCAATCGATCAAAGTGATACTTTAACTGTAACTGTTTCAGATTGGGCAGAT
CTAAGTTAACCATTAATAAACAGAGCAGACGCAATAACTGAAGTAAGTCAGTACTCTAAA
TACACGGCTTCCTTCAACCTTCCGTTTCCTATTGATTCTGGTTGCCGATTAAAGATATTA
TTTCCCTCTGATATGCCAATTGATACCGGACTAACTACAGTGAGCGGAGATGGTTTATTT
AGTAGTTTGACTACTTATACAACAAGAAATGTTGCAACAAATTACTTGGAGGTTGATGGC
TGTTCAACATACTTTGATGGAGGATAGTCAGCATTAGTAAATTTGGATTCTATTCTTAAC
AAAGTTTGGGTTGCAGATACTTAAACATTTACTTATGAACTATATGATATGGCAGGGACA
ACTTATTACAAAATTGCAAGAACTATATCAGGATTAAGCGTACCAATTTCTTCGTTTTCT
CCTGGTAACATTCTCTCTTTCTCTATTGAATCTGTGGACTCTTAGGTAGTTTAGGATTTG
ACTAAATATAAACTTACTTTTAAACCTGAAAATTCTATTCCAACTAACTCTGAAATTCAC
ATTCTCTTCCCTTCCTCAATAACCCTTGTTGATTAAGCTTCCTGTACTTTGAGTAGTGTT
TCTGGGGCAATAAGTTAGAGTGGGTTTACAGCTTGCAAAGTTTAAGGTAATCTTATAACA
ATAACAAATCCATTTGGAACGGGATCTTATACTAAAAATGGTTCAGCTCTTTCATTCATT
TTTAGTGTGGGAGGTACTAACCCATCTACAGTGTAAGACGCTGGGTCGTTCCAAGTTTCT
ACATTTGGTATATCAGGGAGCAACACCTATGCAATCGATGACCAGAGTTTCACAAATGTG
TACAAACCTACACCCTCACCTTTGATTGCACAGGTTCTTACAGTTTCAAGTTTTGTCACT
GGAATTACTCCATCAACTTATACTTTACAGCTGACTCCTAATAAGACTATCCCAGCTAAT
GGGAAAATACTTATCACTTTCCCAACTTCAATTACTTTCCCAACTGGTAGAACAAGCTTT
ACTGGGTGTAAAGTGAATATTGGTGGAGAAAAGCAAGTTGCTTGTGTAGTTTCAACTACT
ACTCCAGCTATTACTTTGTCAATAAGTAATGCTTTTTCTACAGCCTATACCTCCTTGTTA
ACACCATTCACTGTAATCTTTGAAGGTTTATAGAACCCAAGGACGACTTCAACAACTAAT
TCATTCACTATTACGACTACAGGGTCAGATGATAGTCCAATAGAGAGCATTTCGACAGGT
GTGACAACAGCTATGACTTCGAATCCAAATATTGTCCTTTTTTAAGTTACTCCCTAAAGT
TTCATTAACGGTCAAGTTACCGATTATCAAATCTTGGTTCAATCTAGCATCGCTATGTAA
ACTGGAGACATTATATAGTTTACGTTCCCATCAGCTCCTGATTTCACTATCAACTCACCA
AGCTGCGCTGGGTAAACTCTTACGACATCGGTATCATGCACTGCTACCAGTAATACTATC
AAAGCGACAATTACATTCAGTTCAAGCCCTCTAGCTGCTAATAATAATTTTTCATTTTTA
GTAAAATCAGTCACAAATCCTCCAAGTACTAAACCAACAGCTACTTTTACAAATATAATT
GGATTAGATTCAAGTAACAATCAAATTCAATAATTCTTGAATGGCCCAACTATCACAATG
ACAACTCCAGCAACTATTGTAACGAGAAGCTTAACTTAAGCAAATACCAATATAGGAGTT
TAAACTTCTTATACAATAGCATACACTAATTTGAATTTATTGCCTTCAGGTAGTTCCTTC
TTACTGACGTATCCCTCAGCAATTCTACCTTAAATTCCATTGACATAATGCTCAATTTAA
GCAGGCTCAAACACTTTCACAATGTCATCTTGCACAATAAATACTTCAACAAGACAAATA
AAAATAAGTGATGGATTTTCAGCTAATATAGCAGCAGGAAGTCAAGTTAAGATAAACATA
GGATAAATAACTAATCCTACAGATTAATCAAACACGAACTCTTTCACCATGGTTTCTTAT
ACAGACAGTAGTTAAACCTACTCAATTGATTAAATAGCTGATGGTTTAATACCAAGTTTT
GCCTGTACATTGCCATGTAAAACTTGCTCTACTAGTAGTAAGTCTTAGTGTACATCTTGC
TTCACTACTGGTTCCCTTTAATATCTAAGCGGTAGCACTTGTGTAAACTCTTGTCCTACA
GGAACTTTCGCAGATTCAAACAAAATCTGCCAAGCATGTCCAAGTAAATGCAAAACATGT
AACAGTACCGCATGTTTGAGTTGCAATACAGCTGGATCTTTACAAAACTTATACGGAGGT
GATTGTGTAGCTACTTGTCCAGAAGGTTTCTACAACACTTCAAATACTTGTAAAGCGTGC
AACACTACATCTTGTAAAACTTGCTCAGTAAGCCCTACAAATTGCACTTCTTGTAATGCA
AATAAACCCTATCTTACTACAGCTAATTAATGCCAAACTTCCTGTGACCCTGGTTATGTA
TCAATAAACTTTGTTTGCAAAAAATGTACATCACCTTGTGCCACCTGCTTAGTATCCCAA
ACCACATGTACATCATGTCTTTCAGGATAATTGTATGGTACTACATGTATTGCTAGTTGT
CCAACAGGATATACTTTAGTTAATGGACGGTGTATAGGATGTGATCCAAATTGCTAGCTT
TGTTCACCTCTTAACACTGCATAGTGTGCTATTTGTAAGCCTGGTCTTTATCTTATCAAT
GCTACATGCTTCAATTCATGCCCAGAAGGATGGAAGCCTGACCCCTCAAATACTACTTGT
CTTCCAGTATATATACCGCCAACTAACACAACAGTTTCAGTAGCAGTTAAAGAAACTAAT
ATTTATAAGAAAACTTTCGTTTACTTCCCTTTCGTCATCACTATGATCATATTACTTGCA
ATTTCAGTTGGAGGCTGGTACAAAGATAAATCTTCAATTATTCCAGCAAACTGTGTAGCT
ATGTGGGGACCTCTATTGTTTCTAGCTCTTTGTGCCTAAGTGCTCCTATCTTATCTATGG
ATCACTAATATTGCATACGAAGCTGATGTTAAATCATCTACAGTCACCACTACCTCGAGT
AAGCTATAATTGCCAAATCAGTAAATACATGGGAGATTCTTAGGTAACCCTGAAATGCTG
ACATACTTTGATGGAGAAGTATGGCCTTTGCTGTTTTATGGAACAGTTTTTGCACTTGTG
CTGTATATTTTACTGAATCTGGCATTCTTTGTAACATTTTTGGCTTTCATTAGGAGAGAT
CCAGGTTATATTGAATATCGACAGAAACATTGTTGTATACCTGCTATGATAGCTACTGTG
GGAAGTATTGTGGCTTTCTAATTTGTGATGACACTCCTGCCTATTATTTTTATCGACCTC
TATGGGCTACTGAAGTACTAATGGGGTTCACAGTTCTACATAATTATCATAGAAACTTTG
TTATTATCGTTATTCATTCTTGCTTTTACAATATGGGACTTCAAAGCTCAAAAATAGGCT
TTAAAACCACATGAGGCAGAATAATTAGTATATGCCGCTGTACCTGATAGCAGTCTATAT
GAAGACCCTGAAGAAAAGAGACTTAATGAAGAACGTAAGAGATATAATGGAATGACTATG
GAAGAATACCTAAATCATCTCCTTGGAGAAAAAGAAATTGAAAAAGCGGCTTATGGATCT
AAAAGGCCTTTGAAGAGAGGAAACTCAATGATAGATCTTGGAGATCGAACTAAAGAAGAA
GATGATCGCAGAGTCAACACAGACCCATTAGACGAGAAGCAGAAAAAGAGATATGAAAAA
TGGGAGAATCCGTTTGATGCCGATAAATACCCTGATAATTGCTATGCAGTGACTGGTGAT
GGTGAAAAAGCCACTTTGGATCCATCAAAAATAAAAACTAAAGTTATCTAATATGGTAAC
TTTGCAGAGGATGGCGAAGATTATGATAAAGAGTATGAGCGTAAGATTAGAGAATTGTTC
CATGGCAGAAATCCTGCTGATGAACGAAACGACATGCGTTATCTAAACAAACTAGGCGGA
GACACTACTGATTAAGAATTAGGCTTTTCAAGCAGGAAAAAGAACAGATTAAGAGGAAGA
AAAGGAAAGTACTATGAGCAAGTTGATGACGAAGATCAAACATTCCTCAATGATTAAGAG
AGAAGCATGCATGGACCAGACGATGAAGATGATCTTGGTTATGGTGATGAAGATGCCAAA
GATTTGCATATGATTGAAGAAGAGAGTCAACATGACCACGATGAAAATGATTAACTCGCA
AAGAAACTTGATGATTAGGCACTTGACAGTAGCATTGTACCTCTGATGGATGATGATAAG
AAAGATGAGGATGGCAACAACAGCAGTAATGGAAATGGTCATGATGACACATAAGCTAAT
TTAATGGGAGTGGGAGATGACGAGGTGCAAGATGACTATTAAATGTTCGAAGCTGAGGAA
GCTAAGGGTGATATGACTATGTTGGAAATGCCACAAGATTAAGCAAAAATAAACTCACCA
AACAAACTGCTACAACAAGATATCGATGACAAAGCTCTAGAGGATATTGTTGATGGTGTT
GATGATTCATCAAAGTAGTAAATGGATATTGATGGCACTAATCCTCAGTTTAAGACCACT
ATTTAAGTGCATGATGATATTGCAAATGATCCACTATTGATGACTTCAAGAGGAGATGAT
AATACCAATTAGCAGCCTATGTCACCTAAACCAGAAGATTTTCATAAATAAGAGGAGGAA
ATCATCAGAGATCACAATGATTAATCGGATGTGACTGGTGAGCCTGACAGTGACGATGAC
GATGATTAGCGCATTGCCAACATGAGAGACCCTGAAAAGCGTAGATTCAACGTAAATGAT
ATATTGGGAGATTTTGATAGAGACGAGAAGGGTAACTTAGTGATTCTTCAAGAGAATAAA
AGTGGCAATCTGATTGACAAGGATGGAAATAGAGTTAATGAAAAAGGTTATCTCATTGAT
GCAAAAACAGGTGATGTGGTAGAAAAAGAAAAAGGAAGGAAGATATTTGATGCCAAGGAG
CTTGACGAGAGAGGAGAACTTCCACCACCCTACAACCTTGAGAGATTCAATTTTAACATC
CATGATGTCCGTGGATACTTCGATAGAGATGACCATGGAAATGAGATAATAGGCAATAGA
AGGGATGCCCAGGGGCATTTAGTTGACAAACAGAGCAGAAGAATTAATGAACATGGTTAT
CTAGTCGATTCAGAAGGAAATTTAGTTGATAAGCGAGGAAGAGTAAAGATGCATAAGTAG
ATCATGGAGTAGAACAGCGGGGACTTACCACTTTTATTCAACTATAAGGGCAAGAAATTT
GACATTCTAGATGTTATGGGTAACCTAGACAAAGACAGAAATGGAAACATCATTATTAGA
AGAGACAAAGATAACAACATGGTTGATAAGAAAGGCAGAAGAATCAACAATAAAGGCTAC
TTAATCGATGAGCAAGGAAATGTTATTAATAAAGATGGGAAGATTATGTTTGAGAATTTT
GCCTTATCAAAGGATAACGAGATCCCCAAACTCTTTCCATTCTTGAAGTTCAATATTGAC
GATATCAAGGGTGATTATGAAATGGACCCTTTAGGGAATCCCATGTTACAAAAAACTAGA
GATGGAAACTTAGTTGATTCCAAAGGAAGAAGAGTAAATGATAAAGGTTACTTGCTGGAT
GAGAATGGTAACATTAGAAATAAGCGTGGCTATAAAGTGTTCAATCATAACTTACTTGAG
GAGGGTGATATTCCAAAAGTATTTAGAACAGGCTTGTTAAGGAAGGACACCTACGATTCA
TTCTCTTAATTGATGAGTGAAATTGAAGACTTGGAGAGGATGCAGGAGATGGACATCGAT
GATCCCAGAAGACAGGTAATGAAAAACAAAATGGCAAAAGAAAATGAGAGATTGCAAAAA
CGCATAGATAAAATCGTAGAAGAGGATATTGACGACGATGACATGCTTATGAGGGAAGTT
GAGAAACTTGCCTAAGGCAATAACTCAGACAATGAAGCAGGAAATACTTCAGTAGAAAGC
CAAATGGAAGATACACCAAGTAACTATAATGCTATGAACCAAAGATTCAATGAAATTGAT
GATATTAAGAATCAAGCAAGAATTAATGCTAGAATCTAGAGAGCAGTACCAGAAGAGTTT
GAATATGAAAGTGACTACTCTTACTTACCAGGCAAAAAGCTAAAGAAAAAGAAGAAAAAG
AAGAAGAAGGTAAAGAAAGAGTAAGAAATAGACTTGCGTGAACTAAAAATGGCTGTAGCT
TATGGTGGCCTCACTCAAGCCTAGTATGACAAGATAGTGGCTACTAAAAAGATTAAAGAT
GCCCAAAACATGGCTGCTTAGATGGGGGCAACCACAATGAGTTAGCTAGGAGTGAAGCCG
CCTATTCAGAGAAATGCAAGCAACACCAGAATGACCACAGTTTAAAGCAAGAGAGGACCT
ATTGGATTCAATTAAAGACAAAACAGTGCTATGGGTGACGACCTTCAATCTGATTTTGGT
GGAGCAGAAAGCATCAATTTAAACAACAATATTCGACCAGGATTAGGAATGCAGCCTTAA
CTTAGAATGGGTACATCAACTACAAGAGCTAACCTTAATAACATGAATAAGACCACTTCA
AGATTAAATAATACAGAGCAAAAGTTCATCGCACCTTAGTCCTTGAAGAAAAATAACTTA
ATGAGTGATAAGGGAGATAACAACAGTTAGCTTTCTGACAAATTATAAAACAATAATTAT
GTTGAGAGAGATCGAAGACTTTCATAAATAGCTAACTCAGTATCTGGGTTCTACATCAAT
AAAGAGGGCAGTGAGTAATCATTAATGAGATCTACTCACGAATCTAACTTTGCCTAGAAC
TTGGGAAAAATAAACAAGAGAGGATTAAACAACCAAATGGAAGAATCAAAAGGACCAAGC
ATGAGACCTCCAAATACAGCAGGTTTTGCTCTTGGAGGTTAAACTAATGACCCAGAATTG
GATCGCATTTACGGAACAGCTAGAGGACTTGCTGACTTAACCTAACTCAGTGATTGGGAG
AAAGAATCGCAGAGAAGTGAGGTCTGGAAAATATTTATCTTCAAAGACTTGAACCAGCCT
CTAAAGGAAGAAAAACCACAATGA


>Contig1040.1.g122(protein)
MQTYFNKQTRMLFIALTLIIMLSQQFANAQVQFRTISGSPTPQTVGAQSVLQFLSLLPTG
NNYATGDTLVYTVPSPGSFTPSTSVSLCQSQTSGIVVTSCTITANIVTLTISTTGTLTTF
IVNVQNFKNPPSTQTITGFSVTLSNATATKATLSGGVIQNFRPDSLNAAAITPNSSKIGD
SQSALTISLTPKNNLNTDGRIYVEFPIYNPQSSQEDHMMQQETPTCTGITNMKSSITCSY
DKVRRRLTLTSMIDNNVSGGSTALTFQVDSFMNPYSGIPKTGFYISTADSNGNQVDISSS
LSVTSTEWAEFLSASFERKDTVTTVNELSTGLVIFDLNLHLEINCRLRIDFPTDQPLTSD
LTSIFGANIFQNGQIRTLNIAGNYMEIDGCQSPSVPTSKAYIELNQILNANQVKETQSFQ
FSLFAVSNSQTYRIAKQSIDLKIESTQLTPGGITSLKVEAVDSKVIQTTTRFKVTILPEH
SIPTTSKIIVKFPTSITLTDQTACTLSSVSGGISSSPGSCVVSSNTITITNPFGTGSYTK
NGSALSFIFSVGGTNPISVKDAGQFEILTESLVDTTYYTIDAGVFSSIYLPDPFILAASV
TSVSSYQTYFSPASYTIDINPNKVIPIGGLINVKFPQQISLLNTGIGLTSCQLKIGSVLT
SLSQCVISSTSPVTVSIKDAFSSTAYTSTGTAFELILGGLINPRTTSTTDSFSISTTDSS
SYAIESLSTGITVKMNSTPDISEFKATPSSLITGNKATYLFQVKTGIPILSTDSITFKFP
DELTLPSPLICTGVTLITTVTCTLTSTNTIKATFTQVSSGVIAANTEFAFNIANIDNPSS
TKPTTAFSGIIMNDANGVQITQYTGSSVSVSMTTPATVLTKSITQDSFALSTNTLYTLTY
TTVNSMASQAGFLINYPSTVSLTSLSTCKITHLTIQYAMSCQLTTSTRLIKLSSGLTVPV
TKGDQIQIQLGDIKNPASQQANESFSLTSYTDSTFQYAYDNIPNGLVPQFECNYPCATCP
SGDKSKCLSCITNVAGEIYTYLSGTTCLASCPDGTYSDSNMICQQCPSECKTCSNSSTCT
SCDTTTIYAYLLEGWCYTSCPNGMCSDKFSCVFCTLDQFRNVIVTPTTKTVSTQNNTVSF
NALLPTGKTYTNGAIITYTIPSPASFTPSTTASFCTSLTTGINIQSCVIMANSVAVKIQA
NVETLTSFTIRIGNFNNPPSSCDVNGISVRMVNSVGDSVAEYSSATLSGLVPAKITTVSL
TSSSTKVATTGNTLAVSFNVVTTLTTSSYIQLQLPYWNPDSTTPQHFIESPNPTCIGSSP
LRSSISCTYTLDSLRKLSARTIMDVASVSSGVSVGFTISDFVNPYSTAPKSGFQITTYDI
NGCSIDQSDTLTVTVSDWADLSQPLINRADAITEVSQYSKYTASFNLPFPIDSGCRLKIL
FPSDMPIDTGLTTVSGDGLFSSLTTYTTRNVATNYLEVDGCSTYFDGGQSALVNLDSILN
KVWVADTQTFTYELYDMAGTTYYKIARTISGLSVPISSFSPGNILSFSIESVDSQVVQDL
TKYKLTFKPENSIPTNSEIHILFPSSITLVDQASCTLSSVSGAISQSGFTACKVQGNLIT
ITNPFGTGSYTKNGSALSFIFSVGGTNPSTVQDAGSFQVSTFGISGSNTYAIDDQSFTNV
YKPTPSPLIAQVLTVSSFVTGITPSTYTLQLTPNKTIPANGKILITFPTSITFPTGRTSF
TGCKVNIGGEKQVACVVSTTTPAITLSISNAFSTAYTSLLTPFTVIFEGLQNPRTTSTTN
SFTITTTGSDDSPIESISTGVTTAMTSNPNIVLFQVTPQSFINGQVTDYQILVQSSIAMQ
TGDIIQFTFPSAPDFTINSPSCAGQTLTTSVSCTATSNTIKATITFSSSPLAANNNFSFL
VKSVTNPPSTKPTATFTNIIGLDSSNNQIQQFLNGPTITMTTPATIVTRSLTQANTNIGV
QTSYTIAYTNLNLLPSGSSFLLTYPSAILPQIPLTQCSIQAGSNTFTMSSCTINTSTRQI
KISDGFSANIAAGSQVKINIGQITNPTDQSNTNSFTMVSYTDSSQTYSIDQIADGLIPSF
ACTLPCKTCSTSSKSQCTSCFTTGSLQYLSGSTCVNSCPTGTFADSNKICQACPSKCKTC
NSTACLSCNTAGSLQNLYGGDCVATCPEGFYNTSNTCKACNTTSCKTCSVSPTNCTSCNA
NKPYLTTANQCQTSCDPGYVSINFVCKKCTSPCATCLVSQTTCTSCLSGQLYGTTCIASC
PTGYTLVNGRCIGCDPNCQLCSPLNTAQCAICKPGLYLINATCFNSCPEGWKPDPSNTTC
LPVYIPPTNTTVSVAVKETNIYKKTFVYFPFVITMIILLAISVGGWYKDKSSIIPANCVA
MWGPLLFLALCAQVLLSYLWITNIAYEADVKSSTVTTTSSKLQLPNQQIHGRFLGNPEML
TYFDGEVWPLLFYGTVFALVLYILLNLAFFVTFLAFIRRDPGYIEYRQKHCCIPAMIATV
GSIVAFQFVMTLLPIIFIDLYGLLKYQWGSQFYIIIIETLLLSLFILAFTIWDFKAQKQA
LKPHEAEQLVYAAVPDSSLYEDPEEKRLNEERKRYNGMTMEEYLNHLLGEKEIEKAAYGS
KRPLKRGNSMIDLGDRTKEEDDRRVNTDPLDEKQKKRYEKWENPFDADKYPDNCYAVTGD
GEKATLDPSKIKTKVIQYGNFAEDGEDYDKEYERKIRELFHGRNPADERNDMRYLNKLGG
DTTDQELGFSSRKKNRLRGRKGKYYEQVDDEDQTFLNDQERSMHGPDDEDDLGYGDEDAK
DLHMIEEESQHDHDENDQLAKKLDDQALDSSIVPLMDDDKKDEDGNNSSNGNGHDDTQAN
LMGVGDDEVQDDYQMFEAEEAKGDMTMLEMPQDQAKINSPNKLLQQDIDDKALEDIVDGV
DDSSKQQMDIDGTNPQFKTTIQVHDDIANDPLLMTSRGDDNTNQQPMSPKPEDFHKQEEE
IIRDHNDQSDVTGEPDSDDDDDQRIANMRDPEKRRFNVNDILGDFDRDEKGNLVILQENK
SGNLIDKDGNRVNEKGYLIDAKTGDVVEKEKGRKIFDAKELDERGELPPPYNLERFNFNI
HDVRGYFDRDDHGNEIIGNRRDAQGHLVDKQSRRINEHGYLVDSEGNLVDKRGRVKMHKQ
IMEQNSGDLPLLFNYKGKKFDILDVMGNLDKDRNGNIIIRRDKDNNMVDKKGRRINNKGY
LIDEQGNVINKDGKIMFENFALSKDNEIPKLFPFLKFNIDDIKGDYEMDPLGNPMLQKTR
DGNLVDSKGRRVNDKGYLLDENGNIRNKRGYKVFNHNLLEEGDIPKVFRTGLLRKDTYDS
FSQLMSEIEDLERMQEMDIDDPRRQVMKNKMAKENERLQKRIDKIVEEDIDDDDMLMREV
EKLAQGNNSDNEAGNTSVESQMEDTPSNYNAMNQRFNEIDDIKNQARINARIQRAVPEEF
EYESDYSYLPGKKLKKKKKKKKKVKKEQEIDLRELKMAVAYGGLTQAQYDKIVATKKIKD
AQNMAAQMGATTMSQLGVKPPIQRNASNTRMTTVQSKRGPIGFNQRQNSAMGDDLQSDFG
GAESINLNNNIRPGLGMQPQLRMGTSTTRANLNNMNKTTSRLNNTEQKFIAPQSLKKNNL
MSDKGDNNSQLSDKLQNNNYVERDRRLSQIANSVSGFYINKEGSEQSLMRSTHESNFAQN
LGKINKRGLNNQMEESKGPSMRPPNTAGFALGGQTNDPELDRIYGTARGLADLTQLSDWE
KESQRSEVWKIFIFKDLNQPLKEEKPQ