Identifiers and Description

Gene Model Identifier

Contig1035.0.1.g71

Standard Name

None

Aliases

Contig1035_0_1_g71

Description

Proteasome complex subunit Rpn13 ubiquitin receptor

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Domains

  • ( pfam04683 ) Proteasome complex subunit Rpn13 ubiquitin receptor
  • ( pfam13658 ) Ubiquitin C-terminal hydrolase 37 receptor binding site
  • ( pfam11244 ) Mediator complex subunit 25 C-terminal NR box-containing

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010051305.000574419929632e-30hypothetical protein
SGDYLR421C0.000009002574193719714RPN13 SGDID:S000004413, Chr XI
I from 965560-965090, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1035.0.1.g71(coding)
ATGCAGGGTTTAGATCTTGGTTAAATATAAAACCTAGCTGGTATGATGCAGTAATAGAAC
AAATCTCTTGTTGAATTCAAGGCAGGTAAAATGACATATGATGGAAGAATGGTAAAGCCT
GAGAGAAGAAAGGGAATCATCAGAGTCATCTCAGATCCTTCAGGAATGAAGCAATTTTAG
TATTTGGATGCTGATACCAAGAATCCAATTGATAGCTTCTATGTGTTCCCAGGTGACGCT
AAATTCGAGAAAGTAAAGCAGTCAAAAGACAGAGTTTATATTTTGGAATTCGCCAGCACT
TAATAAAGACACTTCTACTGGATGCAAGAGAGTGACAAGGAAAAAGATAGTGAAAATGCT
ACAAAATTGCATAATACATTGAATGGTATTGCAACTTAACCAGCTGCTACCACTGCTTAA
GCTTCAGCTGGACCCACCTTGGTTTCTCAACAGTAATAACCAGCTACGAGACCAGCTGCT
TCAAGTTAACAACAGTAACAAGTCCCCCAATTTAACGACTTCTTCAATGACCCAAACCTC
ATGCAATCTTTGCTGTCATCAATGGGCCAGCAATAACAATAAGTAAGATCCCCAGGACTT
AATTAATTCGTTACTTCCGAAGCCATGCTTAAGTTAATTGATGAAAACCCTGAAATGAGA
CAGGCACTTATTGAGCAGCTTCCTGAGGGACAACAAAATGAATAAGGTTTGAGGGAAAAT
ATTACCTCTCCATAACTACAGCAAGCACTAGCCAGTTTGACATCAGCTATTTAAAGTGAT
CAAATTTCGATTATTTTGGCTTCACTTGGACTAGATCAAAGTGTATTGAACAATTCCAAA
GACGGAATTGAAGCTTTAGTCAATGCGCTAATTAAGAAATACTCTAACAAATGA


>Contig1035.0.1.g71(protein)
MQGLDLGQIQNLAGMMQQQNKSLVEFKAGKMTYDGRMVKPERRKGIIRVISDPSGMKQFQ
YLDADTKNPIDSFYVFPGDAKFEKVKQSKDRVYILEFASTQQRHFYWMQESDKEKDSENA
TKLHNTLNGIATQPAATTAQASAGPTLVSQQQQPATRPAASSQQQQQVPQFNDFFNDPNL
MQSLLSSMGQQQQQVRSPGLNQFVTSEAMLKLIDENPEMRQALIEQLPEGQQNEQGLREN
ITSPQLQQALASLTSAIQSDQISIILASLGLDQSVLNNSKDGIEALVNALIKKYSNK