Identifiers and Description

Gene Model Identifier

Contig10327.0.1.g114

Standard Name

None

Aliases

Contig10327_0_1_g114

Description

hypothetical protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001555801.0004659174935984e-170Adaptin N terminal region fami
ly protein
SGDYKL135C2.999977985165137e-107APL2 SGDID:S000001618, Chr XI
from 188640-186460, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10327.0.1.g114(coding)
ATGTCGATTGATTTCCAAGGATCTTAGAGAAGTGAAATTTCAGAGTTAGCTCTTGAATTA
AACCATAACAAGCTTGAAAGAAGAGTTTCAGCCATCAAAAAGGTAATTGCTTCAATGACA
GTAGGTAAAGATGTCTCAAAATTGTTCTTCCCAGTGCTTAAATGCGTTGAGACCCAAAAT
TTAGAACTGAAAAAGCTGGTGTACTTGTACATCATAAACTATGCTAAGACATAACCAGAC
TTGGCAGTGCTTGCAGTCAATACTTTCAGGAAGGATGCTAGGGAGAGAGTCAATCCTTTG
ATTAGAGGTCTAGCCATTAGAACAATGGGATGTATTGGAGTAGAAGCTATGCTAGATTAC
ATGTGCGATCCCTTGAAAGAGTCTCTTGACGACGAAGACCCATATGTTAGAAAAACTGCA
GCTATTTGTGTTGCTAAACTTTTTGAAGTGAGTCCTTAAAGATTCGATGATTTCAGATTC
CTTCAGCAAATGAAGAGAAAAATTATATCAGATGGAAATGGTATGGTCGTCTCAAACACA
GTTGCAGCACTCAGTGAAATTCAAGCAGCAAGGGGAGAGAAACTAATTGAAATGACTTAA
GAAATAATGAACAATTTGTTGAATGCCATTTCTGAGTGCTCAGAATGGGGTAAAGTCTAC
ATTTTAGATTTCTTGGCAAATAATATAATCAGTGCACCCAAGGATGTTGATGAAATTATT
CAAAGAGTTATACCTAATCTAGTATTACAAAATGTTGCAGTGGTCCTATCAGCTGCTAAA
GTTATCATCAAGTATCTTGATTTTGTTAGTGACACAGAAAAGATCCGTTCAATCTGCCGT
AAAATGGCTCCACCTCTGATCTCACTTATGAACAACGACCCCGAAATATAATATGTAGCC
ATCAGAAACATAAACTTAATTATTCAAAAGAGACCTTACATTATAGATAAGGAAGTTAGA
GTATTCTTCTGCAATTTCCAAGATCCACTCTATATTAAACTTGAAAAGCTTGAAATTATG
ATTAAATTAGCAGACTTAAAGAACGTTGATTCATTACTTAATGAGCTTAAGGATTACGCT
TAAGAAATCGATGTATAGTTTGTAAGAAAAGCAATTTCTGCAGTGGGTAGAATAGCAATT
AAACTCGAGAGAGCAGCAGACCGCTGCATCCAAGTCCTACATCAACTTATAAACACAAAA
ATTGATTACGTAGTACAAGAAGCAATTATCGTGATTAAGGACATTTTCCGTAAGTACCCA
AATAAGTATGAGAGCATCATTAAGGATCTGTGTGAAAATTTAAAAGCACTGGATAACACT
GATGCTAGAGCTTCGATGATTTGGATTATTGGGGAGTATGGCGATCGCATTGATAATGCA
GTGGATTTGATGCTTAATTTTAGTGAGAATTTCAAGGATGAAGCCAAGAAAGTTCAACTT
GCTATACTCAATGCCAGTGTTAAGCTATATTTAAAATTAGAATCTTAGGCAGAGGATTTA
GTATAAGAAGTACTCAAACTAGCCACAGACGAAAGTGACAATCCAGATCTCAGAAATCGT
GGATATATCTACTGGAGAATGCTTTCAAGCAACCCAGAACTTGCCAAAAGAATAATCTTA
TGTACTAAACCTACTATTAGTGAGGACAGTTCAACCATCGAACCCCAACTTTTAGATAAA
TTGATAGATAATGTGGGCATGCTGAGCAGTGTGTACTATAAGCCACCAGAAGCTTTCGTC
AAGAAAATCAGAGACAAAATCAATGAGAGATTAGACTTGGAAAATGACGATGACTTATTG
GGGGGAGTCAGTGGACCAGGAGGTTAAAAGAAGCCGTAGGAGGACTACCTAGATTCAGCT
GGTGTTGCTAGATCTTAATATCAAGACAACCAAGCATAGGGAGTGTATAATTACTCACAA
GACCTATTGGGAGTAGATGATAACAACAACGGTGGAGGTAGTAACACTAATGCCATTGAT
GATTTATTGGGGATGGGCTCTCCATCAATATCAAGTAATATATAGCAATAACAACAGCTC
AGTGGAATAACTGATATAGATGATCTATTGGGAGGAGGACCATCAACACAAATAAACACT
CAGACAAATCAAAGTTCAAATATGAGTGGAAGCTTGATTGATATGGATATAATGGGTAGT
GATTAGTAACAACCAATTTAAATTAATAGAGTTAAGGTCCCCTTTTAAACTGTTTGCAAT
TCTCAGAAACAAGGTAGCATTAACAATCAGGTAGGATTGTAAGTGGAAGCAGCATTCTAG
AGAGAAAACGATTAAATATTCTTAGAGATGAAAATAACCAACCAAACTTCTCAACCCTTG
ACTGAATTTATGATGAAATTAAACTAGAACTATTTTGGCATTGCACTTGAAGAGATGATG
CCAGCAGGTTTTAATGTTATGCCTGGCGAGTAGAAAAGTGTCAAGTTGAGATGCCAGGCT
TTGAAATAAATGGGTGGAGAACCTCCAGCTAGACCCCCTATTCTTATTCAATCAGGTATT
AAGTGCAACTTAGATTTGTTCTATTTCGATATACCAGTTTTAGCCTAAGTACTATATACT
AAATAAAATCCTAATGCTACAAATACTGGCTACTTGCAAAGTGTCAAATGCACACTCTTT
AATGTCAAGATTGCAAGATAACAATGTGTATTTCATGCACTAAGGTACAAATGA


>Contig10327.0.1.g114(protein)
MSIDFQGSQRSEISELALELNHNKLERRVSAIKKVIASMTVGKDVSKLFFPVLKCVETQN
LELKKLVYLYIINYAKTQPDLAVLAVNTFRKDARERVNPLIRGLAIRTMGCIGVEAMLDY
MCDPLKESLDDEDPYVRKTAAICVAKLFEVSPQRFDDFRFLQQMKRKIISDGNGMVVSNT
VAALSEIQAARGEKLIEMTQEIMNNLLNAISECSEWGKVYILDFLANNIISAPKDVDEII
QRVIPNLVLQNVAVVLSAAKVIIKYLDFVSDTEKIRSICRKMAPPLISLMNNDPEIQYVA
IRNINLIIQKRPYIIDKEVRVFFCNFQDPLYIKLEKLEIMIKLADLKNVDSLLNELKDYA
QEIDVQFVRKAISAVGRIAIKLERAADRCIQVLHQLINTKIDYVVQEAIIVIKDIFRKYP
NKYESIIKDLCENLKALDNTDARASMIWIIGEYGDRIDNAVDLMLNFSENFKDEAKKVQL
AILNASVKLYLKLESQAEDLVQEVLKLATDESDNPDLRNRGYIYWRMLSSNPELAKRIIL
CTKPTISEDSSTIEPQLLDKLIDNVGMLSSVYYKPPEAFVKKIRDKINERLDLENDDDLL
GGVSGPGGQKKPQEDYLDSAGVARSQYQDNQAQGVYNYSQDLLGVDDNNNGGGSNTNAID
DLLGMGSPSISSNIQQQQQLSGITDIDDLLGGGPSTQINTQTNQSSNMSGSLIDMDIMGS
DQQQPIQINRVKVPFQTVCNSQKQGSINNQVGLQVEAAFQRENDQIFLEMKITNQTSQPL
TEFMMKLNQNYFGIALEEMMPAGFNVMPGEQKSVKLRCQALKQMGGEPPARPPILIQSGI
KCNLDLFYFDIPVLAQVLYTKQNPNATNTGYLQSVKCTLFNVKIARQQCVFHALRYK