Identifiers and Description

Gene Model Identifier

Contig10290.0.g21

Standard Name

None

Aliases

Contig10290_0_g21

Description

Autophagocytosis associated protein (Atg3), N-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam03986 ) Autophagocytosis associated protein (Atg3), N-terminal domain
  • ( pfam03987 ) Autophagocytosis associated protein, active-site domain
  • ( pfam10381 ) Autophagocytosis associated protein C-terminal

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010506204.000521932330652e-52Autophagocytosis associated pr
otein, C-termin...
SGDYNR007C5.000201715856339e-35ATG3 SGDID:S000005290, Chr XIV
from 640114-639182, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10290.0.g21(coding)
ATGAGTATAGCCACTCCTTTTATGGGAGTTCTCAAGGACAGTAAATTCTTGGAGCAAGGT
GTACTAACCCCCGAAGAGTTCATGATAGCAGGCGACTAATTGACTCATAAATGCCCTACT
TGGAGGTAACTTTGCTTTTATTTCTAAGTTATTGTATTTAGTTGGGAAGCTGGTGATCCA
AAGCTAAGAAACAAGAATTTGCCAGAGGAGAAGCAATTTTTGGTTACTAAGCACGTTCCA
TGTTCAAAGAGAATCAAAGAACTTCAAGGAGAGGAAACTAAAGAGAGAGATTTAGAAGAT
GGATGGGTTGAGACTGATAGCCCAATGGTCAAAGATTCAACTACTGGAAAAGCATCGGCA
GATATCGATGACATTGATGACATTGACATGCAAGACGTAGGTGGAAACACTCATGATTAA
GAAGCTGTTGACATAGACGACGAAGATAATAACGCAGGAACAGGCGCAGCTACAGATAAT
ATATTTGCTTCAAATCAATACATAGTGTAACACGCTCCCGAGGATACTGTGCATAGAGTC
AGAACCTATGATTTATCTATCACTTATGATTTCTACTATCAAACTCCAAGGCTTTGGTTA
CTAGGATATGATGAGGATGGAAACTTATTGAAAGAAGTTGAAGTGTTTGAGGACATTATG
GCAGATTATGCAAAGAAAACTGTAACAATGGAACCACACCCTCATCTTGGCATGAAACAA
GCAAGTATTCATCCTTGTAATCACGCAAAAGTTATGAAAAAGATCATCGATACTATTCAA
AGTAATGGCGGTACACCTCAAGTTCATTAATCACTGTTTGTCTTCTTAAAATTCATTTCA
AGTGTGGTGCCAACAATAGAATACGATTTTACAATTGATCTAGAATTAGATTGA


>Contig10290.0.g21(protein)
MSIATPFMGVLKDSKFLEQGVLTPEEFMIAGDQLTHKCPTWRQLCFYFQVIVFSWEAGDP
KLRNKNLPEEKQFLVTKHVPCSKRIKELQGEETKERDLEDGWVETDSPMVKDSTTGKASA
DIDDIDDIDMQDVGGNTHDQEAVDIDDEDNNAGTGAATDNIFASNQYIVQHAPEDTVHRV
RTYDLSITYDFYYQTPRLWLLGYDEDGNLLKEVEVFEDIMADYAKKTVTMEPHPHLGMKQ
ASIHPCNHAKVMKKIIDTIQSNGGTPQVHQSLFVFLKFISSVVPTIEYDFTIDLELD