Identifiers and Description

Gene Model Identifier

Contig10286.0.1.g44

Standard Name

None

Aliases

Contig10286_0_1_g44

Description

Calponin homology (CH) domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001365102.999881077923457e-136fimbrin-like 71 K protein
SGDYDR129C4.000944328304913e-112SAC6 SGDID:S000002536, Chr IV
from 715247-713340,715379...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10286.0.1.g44(coding)
ATGTATATTTTCTACTATAATTCTTGCAAATTTTTACTTTTTTAGCTCCAACACGCTTTT
AAGTTGTACGATAAGGACAAAAATGGCAGCATGAACGCTGAGGAATTCAAGCAAGTGCTC
GTGGATTTGGGAAAGAGAGACGTCACAGACGCACAAGTCAATGAGATGATCAGTCAAGTA
GACAGAAACAACGATAAGCAGATCTAGTGGGTAGAGTTCCTTGATATGTTTAAAAGCTTG
AAATCAACAAACAAAGACCTATTCAAGCAAGTCCTAACCACTAAGGCCGGTGAAGTCGAG
TAAACCACTACCGAACATGGTGGCACTCATTCTTACTTGGTTGAGGAGAAAATGTGTTTC
ACTAAGCTAATCAACTATATTTTGGAGAAAGACGAAGATGTAGGCGAGAATCTCCCAATC
AACCCAGAGAACGATGATGTATTCCATGCTTTGGAAGACGGATTAATTCTCTCAAAACTT
ATCAATGCAGCTGCCGAGGGAACCATCCTTTGGAAGGCACTCAACACCAAGAAGAACTTG
AACGTTTACTAAGTGAAAGAAAACCTTAACTTGGCTTTGAACGCCTGCAAAGGTATCGGC
CTGAGATGCCCAGGAATCAACTATCAAGCCTTCATCGAAAAGAAGCCTCACTTGATTCTC
GCTGTGCTCTGGCAAATCATGAGAATGTACCTGACCAAGTCCATTGATCTTAAGAACTGC
CCTGAGATCATTAGACTTGCTGAGGAGGGCGAGGAGCTACACGATTTAATCAAGTTGCCA
CCTGAAACTATTCTCATTAGATGGGTCAACTTCCACTTGAAAGAGTCAGGTTAAGAGAGA
AGAATCACTAATCTTGGAGCTGACTTGAAGGATTCAATTGCCTTGACTTACGTTTTGAAC
AGACTTGACCCCGCAAAATGTTCCTTAGAAGGTCTTCAGGAGGAAGATTTGATTAAGAGA
GCTGAGCTTGTCATCAACAACTCCCTATCTATTGGATGCCCACCACTCGTCAGACCATCT
GACATCACCACTGGAAACGTCAAGATTAACACAGTTTTCTTATCAGAGCTTTTCAACACT
AAGCACGGTCTCGAAGAGCTGACTCTAGCGGAAATTGAGAAAATTGGCATGTTAAATGAC
GATATTGAGGGATCTCGTGACGAGAGAGCTTTCAGATTCTGGATCAACTCACTCAACCTC
GAAAACATCTACATCAACAATTTGTACGAAGAGTGCAGCGATGGGCTTGTGCTCCTGCAC
GTCATCCACAAGTTAGACAACACAGTCGTCGACTGGAAGAAAGTGGACAAGAACCCCAAC
AACAAATTCAAGAAGGGAATCAACTGCAGTGTCGCAATTGACGCCTGCAAGAAACTAGGA
ATTAAGGTCCCAGGTATAAGCGGTAACGATTTATTGGAAGGAAACAGAAAGCAAATCATC
GCAATTGTATGGCAACTTGTGAGACTTCACTATTTGCAAATTATTGGCTCTCAAAGTGAG
GAAGATCTCATTAAGTGGGCTAACTAAATGGCCAGTGAAATTCAAGTTAAGAACTTCAAG
GATAAGTCAATAGCTGACGGTCAATACCTTTTGAAACTCTGCTCTGCAATCGAGCCAAGA
GCCATCGACTGGGAAATCGTAATGAAGGGAGAGACTGACGAGGAGAAAGAGAACAATGCC
AAGTACATTCTCTCAATCGCCAGAAAGCTAGGTGCAGTTATTTTCTGCGTGTGGGAAGAT
ATCACAAATGTCAACTATAAAATGATCTTAGTCTTGATCTGCAGCTTGTTCGAGCTGTTC
TAAGAGAAGAGAACCAAGCCAGAAGAATGA


>Contig10286.0.1.g44(protein)
MYIFYYNSCKFLLFQLQHAFKLYDKDKNGSMNAEEFKQVLVDLGKRDVTDAQVNEMISQV
DRNNDKQIQWVEFLDMFKSLKSTNKDLFKQVLTTKAGEVEQTTTEHGGTHSYLVEEKMCF
TKLINYILEKDEDVGENLPINPENDDVFHALEDGLILSKLINAAAEGTILWKALNTKKNL
NVYQVKENLNLALNACKGIGLRCPGINYQAFIEKKPHLILAVLWQIMRMYLTKSIDLKNC
PEIIRLAEEGEELHDLIKLPPETILIRWVNFHLKESGQERRITNLGADLKDSIALTYVLN
RLDPAKCSLEGLQEEDLIKRAELVINNSLSIGCPPLVRPSDITTGNVKINTVFLSELFNT
KHGLEELTLAEIEKIGMLNDDIEGSRDERAFRFWINSLNLENIYINNLYEECSDGLVLLH
VIHKLDNTVVDWKKVDKNPNNKFKKGINCSVAIDACKKLGIKVPGISGNDLLEGNRKQII
AIVWQLVRLHYLQIIGSQSEEDLIKWANQMASEIQVKNFKDKSIADGQYLLKLCSAIEPR
AIDWEIVMKGETDEEKENNAKYILSIARKLGAVIFCVWEDITNVNYKMILVLICSLFELF
QEKRTKPEE