Identifiers and Description

Gene Model Identifier

Contig10272.0.g7

Standard Name

None

Aliases

Contig10272_0_g7

Description

Kinesin motor domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam00225 ) Kinesin motor domain
  • ( pfam00415 ) Regulator of chromosome condensation (RCC1) repeat
  • ( pfam13540 ) Regulator of chromosome condensation (RCC1) repeat

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001853609.997093137033517e-262Kinesin motor domain containin
g protein
SGDYGL216W1.9997255150861791e-53KIP3 SGDID:S000003184, Chr VII
from 84885-87302, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10272.0.g7(coding)
ATGAATTCTCAAAAAGCTCAGCAGCAAAACATGCAATAAAATGTTCTAAATAACAATCAA
GTCTCCTCAATTTAGAATCAATCCAACAAGATTAATGCAGAATAAATTAAAGTTTGCATA
AGAATGAGGCCTCTGCTGCCTCCTTATGAAGATCAAGATGTCTGGGGAGTTGACTATAAA
GACAATAAAATATTTTCTTTAAATTCAAACCTTGCAAGCACTCTTGACCCTGTTTAAATT
GCAATGGGACAAATGGGCAATGGACAATAAATGAACATCAATGCATTTATCAGAGAGAAA
GAATTGAGAAGAAGATATCAAGATGCAATGCAGACATAGAGCTTCAATTTTGATAATGTA
TTTGGCATCGATGTTAAAACTCCTCAGATTTATCATGTTATTGCAAGACCAATTACTAAA
GCCGCTCTACAAGGCTATAACGGGACAGTTTTTATGTATGGTCAGACTACCTCTGGAAAG
ACTTACACTATGTTGGGAACTCAAGATATCCCAGGTATATTGCCTTGTGCTGTCCGAGAT
GTGTTTAACGGGATTAAAAATGATTCAGTCAATAATGAGTATAAAGTTTGGGTCTCATAC
ATGGAGATTTACAATGAATGTATTAACGACTTATTAGCTCCTGGAAAAACAAATTTGAAA
ATAAAAGAAGACCCTAATCACGGAGTTGATGTCGCTGATCTTAAAAAACAGCAAGTTTTT
TCATTTGATCAAGCAATAATTTTGATGAATTATGGTGAAGAGCATAGAATTTATAAAGAG
ACAAGTATTCATGAGCATTCCTCCAGATCCCATACCATTTTCAGATTGTACATTGAAAGT
TGCCCACTTAACAAAGCAGGACCTTAAAGATACTCAATGCTAAATTTGGTAGATTTAGCT
GGGTCAGAAAGGCTAAACGATTTTGAATCTAAATCAGATACTCTAGGGGAAACTGGCTAT
ATTAACAAATCGCTGTTTATTCTTTCTAATGTAATAAACAAGCTAGCTGAAGGGAAAAGC
GGGCATATCCCATATAGAGACTCCAAACTCACCAGAATCTTACAAATGGCTCTCGGAGGT
AACTCCCTAACTGCTATTATTTGTACAATTTCGCCAGCAGCCATAAACTATTATTAATCA
TTGTCAACTTTAAGATTTGCTACTAGAGCTAAAACAGTTAAAAACAAGCCATGTGTCAAT
GAAATAGTTGATGAATAAGAATTCATGAATTAAATGTACAAAAAAGAGATAGAACAGCTG
AGAGAGCAGGTCGCTATTAAAGAATCAGAACTCATGAAATATCATGAATCACATTTGAGG
CTTTAGCAAAATTTAAGCTAAGAAAAGGAACAAAAAGAACAATTAAACAAAGAAATATTT
GAGATAAAGAGTCAAACACAAGCTTCATAGTAACATTAAGAAGAAAATCATTATAAAGTT
GAAATGTTAAAAAATAAATTGCAATAAGAAAGATAAGAAAAAGAGGAGCTGATTAATCAA
GTAGAAATGTTAAAGCAACAAAACTTTGTAAATAATCAAACTTAAAATTTTGCTAGTGAG
GAGACATCAAAATTTATAGAAAATCTCGCTTAATAAATTGAAGAAGTATTGATCGAACAA
TTTAACATAGAAGAAAACTAAGAATATTTCTATCAAATTCCAGAAGAGAAAATTCAACTT
TCTTAAAACTAACTCTGGGTTAGTGAAGTTGATAAGCTCTCATCAAATTACAAAATTGAC
TTATTAAACTTACAAATGACTTACAAGCAATAAATGCAAAATGTTCTCTAATCTATCTAC
AACTAGTAAAACGAATAATTTCTATTAAATATGATAAGTGAGGGAGTACTAAAAATATCT
GAGACTACTCAAAGAGAGAATTCTTCTCAATTTGCAAACGCAGAGAAAGTCTTGCATGAT
ATAGATCAAGGCATAGTCTTTGATGATGTTTTGATTGAATATGAAGAAGTGTACATGAAA
TCGATTTAAAGTCTAGGTCACAATATGACAAATTTAATGAATGGTTTGATCTTTCCAAGC
AAAGAAGAGCTCAATAAGGTTATTGAAGACTTGAAAGAATACTATGGAGAACTTATTCAA
GTGGTTCAAAAGAGATACGACGAAGTGAAGAACATCTTGGAAACTTATTTCAGGCAATTA
ATCGCTATGAAACGCGAGGAGCTAGATATCAAGCACGAAAACGATGAAATCAGCGAAGAA
GACTTCCAAGAACAAGCTAATACATTCGCTTAAATCACAGATACTCATAATGAAAAGCTA
ACTAGATTAAGAGAAAGCTTTGATGCTTTTTCTAGACACATTGATGAGAGATTCGATGAG
CAAATTGAAAAGATAAATCATCAATTCAATGAAGTTGAAATAGACTTCCAAGAGTCAGAT
CAAAGCGACATTGATTCGTAGTTAAGAAATATTTAGTAGAGATAAAATTTTAAGCAAAAT
AGCTTCACACCATAGAGTCAAAGGCAGAACAATGATTAAGGAATTCAAAACTAACTAATG
ATGAATCAAAGAGATCTCAACAACTTTTAAATGAGTATTCATAGCATGTAAGAAGAGCCA
CCTGAAGTCAGGGCCTCAATTAACTCACATCAATAAGTCACTCCCACCCCTAAGTTTTCT
CAATCAAACAAATTTAGGAACTAGTCTTCAGCTCAAAGAAGCAACAAAGAGAATAATTAA
ACTATTAAGCAGACTTATGGAAGCTATGATAAGAAAGAATAAATGCAATTACTACCAAGA
ATTAAGCTCAAAATATTTGGATAAGTAAATAAAAACTAGAGTTATAAAGTTTTTGTGTGG
GGAAGCGGGAAAGATGGTCGATGTGGAAATGGGAAAGAAAGCAGCGAAAAATTACCAAAT
TAAGCAAATACAAGTCATAATTTCACCCAGCTTTCTTGCGGTTATCATCATTCAGCTGCT
GTTACAAGTGATGGTATGATACTTTCATGGGGTAGAGGTATCTTTGGGTAATTAGGTCAC
GGAGATACAGAAAACTACTCATTACCAACTCCTATAGAAGCTTTAGTCAAGATTCAAATA
ATTCAAGTTTCATGTGGGTGGTAGCATTCTATGGCTTTAAGTTCACAAGGACGCATATTT
TCGTGGGGCTATGGAGAAGATGGTCAACTAGGCCATGGTGACACAAATGATTATCTTTTA
CCAAAAGAGATAGATTTCTTCCGTAAGAATAGCATAAATGTTGGCATGATAGCTTGTGGC
CATTCCCATTCAGGTTGTATCACAGATGGGCAATCTTCTCAACTTTATCTCTGGGGATGC
AACCCAGATTGCAGACTGATGATTGAAGAAAATGAAAACTAACTTCTCCCAACTCTTACA
ATTTTAGAGTAAGCAAAAATGAAAAATTATGAGAGAGGCGATTAACTTAAACTTGAAGGA
TTAGAACCTTGTTATCTTTCTTTAGGAGTTACTCATACAGCCATAGTGACAAGATCCGGG
GAATTGTATACAGGAGGTTCTATGTTAGATGGCTAACTAGGCGTCAATTATGAAGCAGCA
AAGAATGATTAATCTTATCCATCTTCCCTATCAAACACTCACTAACTAATCAATGAGTCA
AACAGCAGCTTTATCAATCAATTTAAAGACTAAAAAGAGTTAAAGTCACAATCTTTACCA
ATCTACAGAGTAGACTTCTTCAGTGCTTAGAACAAAGCAACTTAGGTTTCTTGTGGAGAC
GCTTTTACTATAGTACTTAATGAGAGAAATGAAGTTTATGCATTCGGAAAACTTTCTCAT
GGGAGACTTGGAGTAGGCAATGGATAAAATCTAAATCAACAAAAAACTAATCAATTAAAA
CAATCAATTTAAAATCAAACTTACTAATCAACTGAGGGGTCAAACGATTGCATAGCCGAA
CCTTAACTTTTGCAAAGTTTATCTCAATCAGAGAAAGTAGTTTAAATTTCAGCTGGGTGT
AGACATGCAGCCTGTGTTACAGACTCTGGAAAATTGTATGCCTGGGGTTTTAACTTCTAT
GAATAGCTGGGGTTAGGGGACAGTGAAAAAGATTTCGATGTGCCAACCAAAGTTAGTAAA
GGTTTGCAATCTAGTAAAGTTAAATTTGTTTCTTGTGGCTACTTCCACACAGGTGCACTG
GTTTAATAAACAAATCAATGA


>Contig10272.0.g7(protein)
MNSQKAQQQNMQQNVLNNNQVSSIQNQSNKINAEQIKVCIRMRPLLPPYEDQDVWGVDYK
DNKIFSLNSNLASTLDPVQIAMGQMGNGQQMNINAFIREKELRRRYQDAMQTQSFNFDNV
FGIDVKTPQIYHVIARPITKAALQGYNGTVFMYGQTTSGKTYTMLGTQDIPGILPCAVRD
VFNGIKNDSVNNEYKVWVSYMEIYNECINDLLAPGKTNLKIKEDPNHGVDVADLKKQQVF
SFDQAIILMNYGEEHRIYKETSIHEHSSRSHTIFRLYIESCPLNKAGPQRYSMLNLVDLA
GSERLNDFESKSDTLGETGYINKSLFILSNVINKLAEGKSGHIPYRDSKLTRILQMALGG
NSLTAIICTISPAAINYYQSLSTLRFATRAKTVKNKPCVNEIVDEQEFMNQMYKKEIEQL
REQVAIKESELMKYHESHLRLQQNLSQEKEQKEQLNKEIFEIKSQTQASQQHQEENHYKV
EMLKNKLQQERQEKEELINQVEMLKQQNFVNNQTQNFASEETSKFIENLAQQIEEVLIEQ
FNIEENQEYFYQIPEEKIQLSQNQLWVSEVDKLSSNYKIDLLNLQMTYKQQMQNVLQSIY
NQQNEQFLLNMISEGVLKISETTQRENSSQFANAEKVLHDIDQGIVFDDVLIEYEEVYMK
SIQSLGHNMTNLMNGLIFPSKEELNKVIEDLKEYYGELIQVVQKRYDEVKNILETYFRQL
IAMKREELDIKHENDEISEEDFQEQANTFAQITDTHNEKLTRLRESFDAFSRHIDERFDE
QIEKINHQFNEVEIDFQESDQSDIDSQLRNIQQRQNFKQNSFTPQSQRQNNDQGIQNQLM
MNQRDLNNFQMSIHSMQEEPPEVRASINSHQQVTPTPKFSQSNKFRNQSSAQRSNKENNQ
TIKQTYGSYDKKEQMQLLPRIKLKIFGQVNKNQSYKVFVWGSGKDGRCGNGKESSEKLPN
QANTSHNFTQLSCGYHHSAAVTSDGMILSWGRGIFGQLGHGDTENYSLPTPIEALVKIQI
IQVSCGWQHSMALSSQGRIFSWGYGEDGQLGHGDTNDYLLPKEIDFFRKNSINVGMIACG
HSHSGCITDGQSSQLYLWGCNPDCRLMIEENENQLLPTLTILEQAKMKNYERGDQLKLEG
LEPCYLSLGVTHTAIVTRSGELYTGGSMLDGQLGVNYEAAKNDQSYPSSLSNTHQLINES
NSSFINQFKDQKELKSQSLPIYRVDFFSAQNKATQVSCGDAFTIVLNERNEVYAFGKLSH
GRLGVGNGQNLNQQKTNQLKQSIQNQTYQSTEGSNDCIAEPQLLQSLSQSEKVVQISAGC
RHAACVTDSGKLYAWGFNFYEQLGLGDSEKDFDVPTKVSKGLQSSKVKFVSCGYFHTGAL
VQQTNQ