Identifiers and Description

Gene Model Identifier

Contig10262.0.g3

Standard Name

None

Aliases

Contig10262_0_g3

Description

Ankyrin repeats (3 copies)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004929202.0006622580855403e-35hypothetical protein
SGDYIL112W0.0000000039998859049333245HOS4 SGDID:S000001374, Chr IX
from 151595-154846, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10262.0.g3(coding)
ATGTCAAGTTTAAGAACTTTATCTGAAAAGAAAGTTACAGATATTTAGCAGCATTAAATG
TTTTTGATTCCAAAAAACATTCAGTCTAGGTAGACATCAGTACCATACAGAAATCATAAT
ATAATTACAGAGACTATTGAAACATCAAAAAGTCTTTCAAAACATGATATGAGCCTCTAA
GTTCCTGATTAAAGATAGACAAGTTTGCTTAAAATCAGAAATAAATTGGCGAATTAAATT
GCTTCGTCTAAGACTTTGCTCTTTAGAAAAGAAACATAGAAATTCACACTTAGAAAGCTA
AACAACCCAGATATTATAAATGAAGTTGTTCTTTTGTCCTAATAATAATCAGCAATAAAC
AATCATGGATTACAAAATGAAGATTAGAGAGTTTTAATTAAGTAGCCTACAATTTCTTTT
AATAAACTTCCTCCTAGACCGTCAATGACTATGATACAAAAATAGGGAACTAAAGTCACT
AAAACAACTCAGAATCCTATAAGAAGAGTGTCTAAGATAGTCGATAAATCTATACTGTTA
AAAAATACTCAAATTGACAAAGAAAAACTAGCTAGGACTCTAGATCATCTTTAAAAAGAT
TTCTTCTCCTGCCCATTAGTTGATGAGCCTGATCCTTAAGAAAAATAATTGCTAGTATTT
CAGTAAAAGGAAATTGAAAATTACCTTAAACAAGAAAAGGAGAAAAAGGAGCAAGTAAAA
AAACTCACTTTAGAACTTGAATAGATTGAAAGACAACTTTACAATTTGTAAGATAGTTAG
AAAAATGGTGGGTCTCCATCTTTAGGCTAGAAATTATAGATGGCACAATTTAACGCATTA
ATAAAGAAAATTAGTGAACAGCTTTTAACCAAGACTCAATCTAAGACTCTTTCAAATTTA
AGAAAAATAAAGAGTTAAATGACCGTGAAGCATTAGTTTAGTAATCCAGAGATAAAAGCT
CTTTAGAACAATGATATTGAATAAGGCAATTTAGCATTTACTTTAATGTCCCCGAAGGAT
TATGCAACTAAAGATATAGAGATGGATCACAATTTAAAGCATAAAGAGAAAAGTATGACA
CTTAAAAATGAACTCGTCGATTTCCCATCATAAGAAGAATAATTTTAAGTTTATAAAGAT
AAAATCAAAGAGATTATGTTAAATTCAAATTTCAGAAACAAAATTGATGATAAAAACAAG
AAAGGAGATATACAGAAAAAGCAATTGTTTATCAAGACACTGATTTTTGCAGTGAATGAA
ATGAAATAAATGAAATTAACTCCAGAAATGATAATTACCGGGTAGGTTTTTCCAAAAGTA
CCTTTTCAAAAAGGTCAACTATCTCGTGATTTCTTTTTCGCTGTAAAAATAGGAGACATA
GACAGCATCGAATAAATGCTAAAAAAAGATAGATTCCTGGTTCATGAATATGATCATGCG
AACTAATCTGCTCTTCACTGGGCTGCAAAAAGAAACAAATCCGCTATTGTGAAGCTTTTA
GTTAAGATTGGTGCTAGATTAAATTAGAGAGATATGGGAGGACGCACACCTCTCTTTCTT
GCTGCCAAATATAATAATTTACAAGCTGTTAAAGTGCTTTTGGCTAAAAAGGCTAATCCA
TTAATCCCAACTCAGAGTTTAGTAACCCCAATTATGATCGCAGAGAATCATAAAATTAGA
GGTTTTATAGCAAAAGCTGTACTGCTACATATTTGTATGCCTTTAATTAATGTTAGAAGG
AGAAAAGCTGTTTGGGAAAATGAAGGTCTTTTGTACTTTAATTCACCTGATAATGCTTTT
ATTTCTGATTTTTCGTGA


>Contig10262.0.g3(protein)
MSSLRTLSEKKVTDIQQHQMFLIPKNIQSRQTSVPYRNHNIITETIETSKSLSKHDMSLQ
VPDQRQTSLLKIRNKLANQIASSKTLLFRKETQKFTLRKLNNPDIINEVVLLSQQQSAIN
NHGLQNEDQRVLIKQPTISFNKLPPRPSMTMIQKQGTKVTKTTQNPIRRVSKIVDKSILL
KNTQIDKEKLARTLDHLQKDFFSCPLVDEPDPQEKQLLVFQQKEIENYLKQEKEKKEQVK
KLTLELEQIERQLYNLQDSQKNGGSPSLGQKLQMAQFNALIKKISEQLLTKTQSKTLSNL
RKIKSQMTVKHQFSNPEIKALQNNDIEQGNLAFTLMSPKDYATKDIEMDHNLKHKEKSMT
LKNELVDFPSQEEQFQVYKDKIKEIMLNSNFRNKIDDKNKKGDIQKKQLFIKTLIFAVNE
MKQMKLTPEMIITGQVFPKVPFQKGQLSRDFFFAVKIGDIDSIEQMLKKDRFLVHEYDHA
NQSALHWAAKRNKSAIVKLLVKIGARLNQRDMGGRTPLFLAAKYNNLQAVKVLLAKKANP
LIPTQSLVTPIMIAENHKIRGFIAKAVLLHICMPLINVRRRKAVWENEGLLYFNSPDNAF
ISDFS