Identifiers and Description

Gene Model Identifier

Contig10229.0.g32

Standard Name

None

Aliases

Contig10229_0_g32

Description

Mitochondrial carrier protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003632104.001242549923285e-107Mitochondrial carrier protein
SGDYBL030C6.998385540567102e-102PET9 SGDID:S000000126, Chr II
from 163997-163041, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10229.0.g32(coding)
ATGGGAGAGTCACCAGTTAGAGGAGGAAAGCATTTCTTCAGAGATTTCATGATTGGAGGT
GTTTCAGCCGCTGTTTCAAAGACTGCTGTCGCTCCAATTGAGAGAGTCAAGCTTTTGCTC
CAAGTGCAAGACGCTTCAAAACATATTGCTTAAGAAGACAAATACAAGGGTATTGTTGAT
TGCTTCACTAGAGTCAACAAGGAACAAGGTTTCAAGTCATTCTGGAGAGGAAACTTGGCC
AACGTTATCAGATACTTCCCAACCCAAGCCCTCAACTTCGCCTTCAAGGACACCTACAAG
AAGGTCTTCTGCCCATTCAACCCAAAGACCCAACCATACATGTTCTTCCTAGGTAACATG
GCCTCCGGTGGTGCTGCTGGTGCTACATCACTCATGTTCGTGTACCCACTCGATTTCGCT
AGAACCAGACTTGCTGCTGACGTCGGTAAGGGCAAGAAGGGAGGTGAGAGAGAGTTCTCC
GGTCTCGTTGACTGTCTTCAAAAGATTTACAAGTCAGATGGTCCAAAGGGTCTTTACAGA
GGTTTCGTTATCTCAGTTATTGGTATCATTGCTTACAGAGCATCATATTTCGGTATGTTC
GATACTGGTAAAGTTTTCCTCTTCGAAGACATCAAGAAGGCTAACTTCTTCGCCATGTGG
GGTTTCGCTCAATGCGTTACCATCCTTTCAGGTGTTGTCTCATATCCCCTCGATACCGTG
AGAAGAAGACTCATGATGCAGTCAGGAAGAAGCCAAGGTGATATCATGTATACTGGCACA
GTTGATTGCTTCAACAAGATCCTCAAGAACGAAGGACCAAAGGCCTTCTTCAAGGGTTCC
CTCTCCAACGTCATCAGAGGAACTGGTGGTGCTCTCGTTCTCGTCTTCTACGACAAGATC
CAAAACTATCTCGGAGTATGA


>Contig10229.0.g32(protein)
MGESPVRGGKHFFRDFMIGGVSAAVSKTAVAPIERVKLLLQVQDASKHIAQEDKYKGIVD
CFTRVNKEQGFKSFWRGNLANVIRYFPTQALNFAFKDTYKKVFCPFNPKTQPYMFFLGNM
ASGGAAGATSLMFVYPLDFARTRLAADVGKGKKGGEREFSGLVDCLQKIYKSDGPKGLYR
GFVISVIGIIAYRASYFGMFDTGKVFLFEDIKKANFFAMWGFAQCVTILSGVVSYPLDTV
RRRLMMQSGRSQGDIMYTGTVDCFNKILKNEGPKAFFKGSLSNVIRGTGGALVLVFYDKI
QNYLGV