Identifiers and Description

Gene Model Identifier

Contig10133.0.0.g101

Standard Name

None

Aliases

Contig10133_0_0_g101

Description

hypothetical protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYEL054C2.000597631390999e-64RPL12A SGDID:S000000780, Chr V
from 53218-52721, Genome...
T. thermophilaTTHERM_000287407.00174216458014e-43Ribosomal protein L11, RNA bin
ding domain con...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10133.0.0.g101(coding)
ATGCCTCCCAAGCCTGACGATCAAGAAAAGAAATTCGTTTACCTCAAAGTCGTTGGAGGT
GAAATCACCAGTGCTGCCGCCCTCGCCCCCAAGTGCGGTCCCCTCGGTATGCCACCCAAG
AAAGTCGGTGAAGATATCTAAAAGGCAACTGCTGACTGGAGAGGAATCAAAATCCAGATT
GAAATGATGGTCCAAAACAGATAATGCTTTATCACCGTCTTGCCAACTGCCGCTCCACTT
CTCATCAAGGCTCTCAAGGAAGGTCCAAGAGACAGAAAGAAGCAAAAGAACGTGAAGCAC
AACGGAAACCTCAAGATGGACGATATTATTGACATCGCTAAGAAGCTCAGAGCTAAGAGT
ATGTCAATCGACTTCGCTGGAACCGTGAAGGAGGTCTTAGGTACCGCTGTCTCTCTCGGC
TGCACTGTTGACGGAAAGGGCCCCAAGGAGGTCACATAACTCATCGATGCTGGTGAAATC
GAGGTTCACGAATGA


>Contig10133.0.0.g101(protein)
MPPKPDDQEKKFVYLKVVGGEITSAAALAPKCGPLGMPPKKVGEDIQKATADWRGIKIQI
EMMVQNRQCFITVLPTAAPLLIKALKEGPRDRKKQKNVKHNGNLKMDDIIDIAKKLRAKS
MSIDFAGTVKEVLGTAVSLGCTVDGKGPKEVTQLIDAGEIEVHE