Identifiers and Description

Gene Model Identifier

Contig59.1.g25

Standard Name

CYCH1

Aliases

Contig59_1_g25

Description

Cyclin, N-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYPR025C0.000000000040005666873964816CCL1 SGDID:S000006229, Chr XVI
from 614558-613377, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig59.1.g25(coding)
ATGGTAGATTTTCAGTAGTCAACACAAAAGTAAGATTGGTTCTTCGATACAGTAGAGCAG
TTTAAGAAAAAACAGATAAAATTAATCAAGAAACAGTATGAGAAAATTGATAAGTTTACT
CAAAAGCCAGCTGGACATGGGCATACTCTTGGGCATCATGTGCCAAACGGTGGGGCATCC
TCGCAACACCCTCCTCATCATGGGTAAAGCAGTAGCAGTGGACACCACAGTAGTAGCAGT
GGATTGCAAGCTCCAATCTATAAAATAGTTAGAGAAGAGCATCAACAGCAGTATATAGCA
TATGTAGTAGGACATATTATTACGGTCTGTACTTAGTTTAGATTTCCACAAAAGATTCTT
GGAATCAGTTTGACATATTTCAGGAGATTCTACTTAAAGCAGAGTGTCTTTGAGTTTGAC
CCCATTGAAATGATGTTTGCCTGTATATACTTAGCACTCAAAATTGAAGAGTACAGTATG
GATTTAGAGACTTTTTGCACGAAAGTCAACCAGAAAGAAAAGTGCACGCCAGAGAAGATT
GAGAGCTACGAGGTGCTTTTGGTCAGAGGGCTTTCATTTCAATTGCAAGTCCTTACCCCA
ATGCATGTTTACGAGTATTTGCTAGAGACCATCCAGGAGTCAATGCCAAGCATGAATTTG
AAGCAGCTCTAAAAACTGACATATGAAAACATACTGAAGTGCTACTTGTCAAACTCCATG
ATCTTCACTTATACACCCTCACACTTAGCATTAGCATGCTTAGATTTAGGTATAACCTAG
ATGAGTTAGAGTAGTGACGAAGGTGAAAACTCGATAAGTTCCTTCACGGAGTATTTCCCT
GAGATTAGTCTTGAGGTTTTGGATAAAATAGGCAAAGCTAAGGAAAATTTACTGCATTAA
AATAAGCCTAAAGATGATGCAATTAAGAAAATTCGCTAGTACATAATGCATTTTCATAAA
ACTCACCCTGAATTCTTACAGCAAGTTAATGATTAAAGAAAGAAGCGTGATGAGAAGGCA
TCTTTATGTGGATTCGAAGATGAACCAAATCCTAATGATCCCCAACAAGCAAATTAATTG
CAAGTGCAATAGCAACCAAAGGTTTAAGAGCAAAGCTAGCAGTAGCTACCAGTAAATCAG
TAAATTAATGTCAGTCAATCACAACTTCCTCCAGTTATTTAATCAAACTAAAGAGATTAA
AATAGACATGATAATAGCATTCACGAATTCATTCCACATCATCCACCAAGTTAAAATCCA
CAAATATAGCATTAGTCTAATTCATTTCAAAACATACCAGTAAATTAGCCTCTCCAACAG
TTCTCTTAACCAGAGTAAAATCCATCAATCAATCAGATGAATCAATTACCTCAGAACTAA
TTAAATATTTTGCAATAAAATTAGCAGCAAGTATTCAAGATGCCAGAAGAGGTGAAGAGA
AGCACCAATACCCCATAAGATGAATTTGACTAGCCCTTGTTGCCTTTGAGAAAGCGCAAA
TCAGAAGCAATCTCTGGAAATTTAGAGTCTAGATAAGACCCCACTAAATTCAGGAAGCTT
AACCCAGATATCTCTCAAGGATTAAACTTAAATAACCCTAATCAGATGATAAATATGCAA
TAAATTTAACAAAATTAATAGCAATAATAATGA


>Contig59.1.g25(protein)
MVDFQQSTQKQDWFFDTVEQFKKKQIKLIKKQYEKIDKFTQKPAGHGHTLGHHVPNGGAS
SQHPPHHGQSSSSGHHSSSSGLQAPIYKIVREEHQQQYIAYVVGHIITVCTQFRFPQKIL
GISLTYFRRFYLKQSVFEFDPIEMMFACIYLALKIEEYSMDLETFCTKVNQKEKCTPEKI
ESYEVLLVRGLSFQLQVLTPMHVYEYLLETIQESMPSMNLKQLQKLTYENILKCYLSNSM
IFTYTPSHLALACLDLGITQMSQSSDEGENSISSFTEYFPEISLEVLDKIGKAKENLLHQ
NKPKDDAIKKIRQYIMHFHKTHPEFLQQVNDQRKKRDEKASLCGFEDEPNPNDPQQANQL
QVQQQPKVQEQSQQQLPVNQQINVSQSQLPPVIQSNQRDQNRHDNSIHEFIPHHPPSQNP
QIQHQSNSFQNIPVNQPLQQFSQPEQNPSINQMNQLPQNQLNILQQNQQQVFKMPEEVKR
STNTPQDEFDQPLLPLRKRKSEAISGNLESRQDPTKFRKLNPDISQGLNLNNPNQMINMQ
QIQQNQQQQQ