Identifiers and Description

Gene Model Identifier

Contig19237.0.g41

Standard Name

CWC25b

Aliases

Contig19237_0_g41

Description

Pre-mRNA splicing factor

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam12542 ) Pre-mRNA splicing factor
  • ( pfam10197 ) N-terminal domain of CBF1 interacting co-repressor CIR

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004089600.0000000029989608248573072hypothetical protein
SGDYNL245C0.0004999512321494991CWC25 SGDID:S000005189, Chr XI
V from 186885-186346, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19237.0.g41(coding)
ATGGAGATTTTAAAAGAATTAGTTCAAAAATAACGATTAGAATGGCAAAAACTTGAGAGT
TGGCCAAATCAACATAATCAGATGGGGGGACTATCTTATTTATCAAAGAAATCTTGGCAT
CCATCCACCTTCAAAAACATCTAAATGGTATGGACTGCGGAGCAAAAGCAAAAACAGGAT
GATCTCAAATATACGTAACACCTAAAAAAGCTTAAGGAAGAGCATCAAATAGAATAATTA
ATTCAGCTATAGAACAAAGCCACCACAGTGACTTCATATAAGGGAATTGATTGGATGTAT
CAAGTCAAATCAGCACATTATAATAATTGCACTGGACCTTCAGCTGAGGAATATCTACTT
GGTATAAAAGTAGAGGATATAAAGGATAAATTGGATCAGGAGAGTAAGTTCGAGAAAAAT
AATGTGCCAGTTACTAATGGGGACTAATATAAAACTTCCTAGAACTAGGGATTTCTAAAA
ATGATGGAAGACCCGCTAGTCTTAATAAAATCTAAAGAACTAGAGGCCAGAAATTAAGTC
TACGATAACTCAAGGGAAATGAAACAAACTATGAACTAAATTGAGGCTCTCAAGAATTCT
ATCAATAACAAAAATAAAAGCAAATAGTATCATAAAAAGGACAAGAAAGATAAGAAGAAA
CAAAAAGATAAAAAACGTCACCAATCGGTCTTAACGATTCTTAATAAGATAAAAGTTACA
ATTAAAGCAATAAAGCATAGAAATAAAGAGAGATTTCAAGGGAACACCATTAAATAAGAG
ATAAAGACCGGGATCATCACTGAGACTACAAAATCTAAGTAAGATTTGGAGAGGAAGAAA
ACTCTTGGCCCAGACATGAAAATCTACGGAGAAAAAGCTCGCTTATAGGAGCAAAAGGAT
AAACTGAGGAAGAAATAGGAACCTACCTATAGCATTAACAGATTAACTCCTGAAGAAGTG
GGGCGTAAAATCCATGAAATGATAGAATACGGTTAGAAAGATAAAGAAGAAAAAATTGAT
AAACTGGAGCAAAAAGGTTAAGAGAACAGCAATGTTTTTTAGTTTCTTTAAAACTAGAAT
TAAATAGCTTAAATGGGAAGCGGACTTAGCTTAGAGAACAGGGTTGGTAGAAATAAACAT
TATTTAAGCAGAGATGCCCTAAGAGAGTGA


>Contig19237.0.g41(protein)
MEILKELVQKQRLEWQKLESWPNQHNQMGGLSYLSKKSWHPSTFKNIQMVWTAEQKQKQD
DLKYTQHLKKLKEEHQIEQLIQLQNKATTVTSYKGIDWMYQVKSAHYNNCTGPSAEEYLL
GIKVEDIKDKLDQESKFEKNNVPVTNGDQYKTSQNQGFLKMMEDPLVLIKSKELEARNQV
YDNSREMKQTMNQIEALKNSINNKNKSKQYHKKDKKDKKKQKDKKRHQSVLTILNKIKVT
IKAIKHRNKERFQGNTIKQEIKTGIITETTKSKQDLERKKTLGPDMKIYGEKARLQEQKD
KLRKKQEPTYSINRLTPEEVGRKIHEMIEYGQKDKEEKIDKLEQKGQENSNVFQFLQNQN
QIAQMGSGLSLENRVGRNKHYLSRDALRE