Identifiers and Description

Gene Model Identifier

Contig9370.0.2.g16

Standard Name

CWC25a

Aliases

Contig9370_0_2_g16

Description

Protein of unknown function (DUF1315)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam07023 ) Protein of unknown function (DUF1315)

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9370.0.2.g16(coding)
ATGCGAGTGATGAGAGCGAATCAGAGAGCAACTCCAGATCAAATAGAATATCCAGTAGAT
GCAGCAGGAGAAGCAGATCGAGTTCATATGACTCTAATGAAAACTCAAGGAGGAGGGTGC
AGTCATCTTCGTCTGAATAGGATAGAACTAAAAGCACCTATCACAAGCAAAGTGGCTACA
CTTCAGAGAAAAGTCATACAAGCAGGGCTACTCACCAGGGTAGATCCAGGTCAAGATCTC
CAGTCAATGGTCGTTATCAAGATAGAAGAGAAAACAGAAGAAGAGAGGATAGACAGTGAT
GACAAGGACCGCCACAGAGACTACAGAAATGATAGAGATGGTAGAGACCACAGGGATGAT
AGAAATAAGCCTGAAATGATTAAGTCAAGCACAAACAAATCTCATGATGCTGGTACTCAG
AATTAAACAGAAGATAAGTCAAGGTAACAAGATCTTGGCCCAGATATGAAAATCTACGGA
GAAAAGGCTCGCTTATAAGAACAAAATGAAAAGCTGAGAAAAAAGTAGGAACCCTCATAT
AACGTCGACAAATTGACACCTGAAGAGAGGGAGCGCAAAATCCAAGAAATGATGGGTTAT
GCCAAGAAACATGATGAAGAGAGAAATATTAAACTATTTGGAAGTGCCTAAGTTCCAACA
AAGGAATCAGCAGCAGATATTATGAAAGAATAGAAAGATTTGGATAACTAGAAAGATGCG
AAATTCCTTAAAAACATAAATTAAGCTGCTTATATGGACAGTGGACTGGGCTTAGAAGAA
AGAATTGGAAGAAATAAGCACTATATTGGTAGAGATGCCAAAAGAGACTGA


>Contig9370.0.2.g16(protein)
MRVMRANQRATPDQIEYPVDAAGEADRVHMTLMKTQGGGCSHLRLNRIELKAPITSKVAT
LQRKVIQAGLLTRVDPGQDLQSMVVIKIEEKTEEERIDSDDKDRHRDYRNDRDGRDHRDD
RNKPEMIKSSTNKSHDAGTQNQTEDKSRQQDLGPDMKIYGEKARLQEQNEKLRKKQEPSY
NVDKLTPEERERKIQEMMGYAKKHDEERNIKLFGSAQVPTKESAADIMKEQKDLDNQKDA
KFLKNINQAAYMDSGLGLEERIGRNKHYIGRDAKRD