Identifiers and Description

Gene Model Identifier

Contig19296.0.g24

Standard Name

CWC22

Aliases

Contig19296_0_g24

Description

MIF4G domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001966209.997093137033517e-262MIF4G domain containing protei
n
SGDYGR278W7.00308173940364e-57CWC22 SGDID:S000003510, Chr VI
I from 1046731-1048464, G...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19296.0.g24(coding)
ATGATTGCTGAATCGGGGCAAATAGCAGCACCAACAAATACTCTTGACTAAGTAAAGTCT
GAGAGTGGTAGACATTAGAGTAGAGACGATAAGAGTAAAGAGAGAAGTAGAACGAGACAT
CGAAGGGATGACTCAAGTTCTGAGGAGAGAAATCACAGGAAAAAGAGGAGAGGAAGTAGT
TCAAGATCATCTTCGTCCCCAAGAAAAGAAAACAGACATCACAAGAGCAGTAGCAGAAGA
GAGGACAAATACGATAGAAGAGGAGGTAAACGCAGATAATCAAGGAGTTACAGCTCAAGC
AGAGATAGAAGTTCGAGAAGAAGACATGATGGATCTAGAAGAGATAGAAATGATAAGGAA
AACTATAGAAGCAGACATGAAAGAGACAGTCACCGAAGATCTTCAAGAGATAGAGATAAT
CGAAGAAACGATGAGAGAAGCGAGAGAGGTAGAGGAGAAAAGAAGTATGAATCTAGAAGA
GACAATTCTAGATCTAGAAATGATAACAAATCTAGAGAAGAACAAAAGAAAGTGTCAACT
TTGCCAGATCGTAGACCAGAGGATTTTGAGGTAGGTACTATGAAACCAGTGGTACCTCAC
CAGAGAAATGCACACATGCCAGCAGCTGCAGGTGGAGTCTATATCCCACCCTTCAAAATG
AAGGCCATGCTTGAAGAATTGAAAAACAAGGAGAAAACCTCAATCGATCACTAAAAATAC
ATGTGGGAGATGCTTCGTAAATCCATTAATGGTATTGTTAACAAAGTGAACACCTCAAAC
ATCCAAAACATCATTCTTGAGTTATTCAATGAAAATTTGCTGAGAGGTAAGGGACTCCTC
TCAAGAGCTATTATGAAAGCTTAAATGGCTTCACCAAACTTCTCGCACGTGTACTCTGCT
TTAATGGCAGTGATTAACACTAAGCTACCAGATTTAGTCAGACTGATTATTAATCGTTAT
ATTATACAATTCCAGAGAGCTTACAAGAGAAATAATAAGATTGTGTGTATGGCTACTACT
AGAATGCTTGCTCATCTTATCAACTAGTAGGTAATTCATGAAATATTGGGCTTGGAATTG
CTAACACTTATGCTTGAAAATCCAACTGAGGATTCTGTTGAAATTGCAGCTGATTTTATG
ATTGAATGTGGTTAGGTACTCACAGATATCACTCCAGCTGGTGTCAATGCAATTTTTGAG
AGATTCAGGACAATTCTTCATGAAGGTGAAATAGCCAAGAAAGTATAATACACCATTGAA
AATCTATTTGCAATTCGTAAAACAAGGTTTGCTGAACACCCTGGAGTCATCCCTGAACTG
GATCTAGTTGAAGATGACGATAAAATCACCCATAATGTGAGTCTTGAAGAGACAGACTTG
GATGGGCAGGAAGAAACCAATGTGTTTTAATTTGATCCTAACTACGAGCAGACTGAAGCT
GAGTGGGATGAAATTAAGAAAGAAATACTTGGAGAAGTTGAAGATGAACGTATTAATAAA
ACTGGTGCTGGCTTAGTAAGGGGTGAGAACGATGAAGAGTCTGAAAGCGAAGAAGAAGAA
GATAAAAACTAGATCTTGGACTTCACTGAGAAGGATTTAGTAAATTTGAGAAGAAATATT
TACTTAGTGATTATGTCCTCCGTTGATTACGAAGAGTGCTGCCATAAATTGCTAAAACTT
AACTTAAGAGAGGGCCAAGAAATGGAACTTTGCAATATGATTCTTGAGTGTAACATGCAG
GAACGTACATACTTGAAATTCTTTGGGTTCTTGGGGCAGAGATTCTGTTAACTAAATGAA
ATCTATTAAGAAAAGTTTCATGAGTTATTTATGAAGCAATATTTAACAGTTCACAGACTG
GAAATTAATAAACTTAGAAATGCAGCTAAATTCTTCGCTCATCTACTTTACAAGGAAGTT
ATAGAGTGGACATGTTTGAGTAGCATTAGATTGACTGAAGACGATACGACAGCCTCAAGT
AGAATTTTTATAAAGATATTATTCCAAGAGCTTGCTGAGAATATGGGCATGGAAAATCTA
AAGAAAAAACTTAATGATGAAAGTCTTAAACCTCACTTAGAGCCACTCTTCCCTAAAGAC
TCAGTATAAAACGCAAGATTTAGCATAAATTTCTTCACAAGTATAGGATTAGGAGCTATT
ACAGAAGAACTAAGAGATTTCTTATAGAATGCACCTAAGTTGCTGCTTGAAAAGAAATAT
GCTGAGTTACTTGCACAAGCTAACGCAAGTTCAGATAGTGACGGAAGTGACAGTGATTCA
GATTCATCTTCTGATAGCAGCAGTAGCAGTGATTCATCCTCTGATTAAAGTGACTCTGAA
GAAGATAAGAAAAAGAAAAAATCTAAGAAATGA


>Contig19296.0.g24(protein)
MIAESGQIAAPTNTLDQVKSESGRHQSRDDKSKERSRTRHRRDDSSSEERNHRKKRRGSS
SRSSSSPRKENRHHKSSSRREDKYDRRGGKRRQSRSYSSSRDRSSRRRHDGSRRDRNDKE
NYRSRHERDSHRRSSRDRDNRRNDERSERGRGEKKYESRRDNSRSRNDNKSREEQKKVST
LPDRRPEDFEVGTMKPVVPHQRNAHMPAAAGGVYIPPFKMKAMLEELKNKEKTSIDHQKY
MWEMLRKSINGIVNKVNTSNIQNIILELFNENLLRGKGLLSRAIMKAQMASPNFSHVYSA
LMAVINTKLPDLVRLIINRYIIQFQRAYKRNNKIVCMATTRMLAHLINQQVIHEILGLEL
LTLMLENPTEDSVEIAADFMIECGQVLTDITPAGVNAIFERFRTILHEGEIAKKVQYTIE
NLFAIRKTRFAEHPGVIPELDLVEDDDKITHNVSLEETDLDGQEETNVFQFDPNYEQTEA
EWDEIKKEILGEVEDERINKTGAGLVRGENDEESESEEEEDKNQILDFTEKDLVNLRRNI
YLVIMSSVDYEECCHKLLKLNLREGQEMELCNMILECNMQERTYLKFFGFLGQRFCQLNE
IYQEKFHELFMKQYLTVHRLEINKLRNAAKFFAHLLYKEVIEWTCLSSIRLTEDDTTASS
RIFIKILFQELAENMGMENLKKKLNDESLKPHLEPLFPKDSVQNARFSINFFTSIGLGAI
TEELRDFLQNAPKLLLEKKYAELLAQANASSDSDGSDSDSDSSSDSSSSSDSSSDQSDSE
EDKKKKKSKK