Identifiers and Description

Gene Model Identifier

Contig1306.0.g17

Standard Name

CTU2

Aliases

Contig1306_0_g17

Description

Protein of unknown function (DUF2392)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam10288 ) Protein of unknown function (DUF2392)
  • ( pfam01171 ) PP-loop family
  • ( pfam03210 ) Paramyxovirus P/V phosphoprotein C-terminal

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007275006.00092892288903e-46hypothetical protein
SGDYNL119W0.00000005999527666938375NCS2 SGDID:S000005063, Chr XIV
from 401040-402521, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1306.0.g17(coding)
ATGGACATCGAAGATCTATTTAATGAGGACCTCAACTTAGAAGAGGAGGAGAAAGAATCC
AGCCACCCCATGATCATCCCAGAGTATGACCCCTGTTCAGGAGGTGGAAACACAACTGAC
GATGCTACCTAAATAAATACATCATAGAGTAATTCTGGTGCTGGTTAATGCTGTCATGGT
AGTACTTGCTCTAGTGGAGCTAAGTCACTAAGTAGCTCTTAGATATTGCAATAGACTTGT
CAAAACGGAGGATGTAGTTGCACTTAAGAATAGAACAAGCAAGCTGAAGATTTGAAGGTG
TAGGAAGAAATCAAAGCTAAATAAGCAGATGATATCAAGTTTAGGTGTTTCAAATGCAAG
AAGAACAGAGCTAATTTCACTAATAAGCAAGACAAAGTTTGCAAGGACTGTTTTAAGGAG
ATGTTTGTACACAGATTTAAACAGTCCCTTAGAAGCAATTTGAAGATTTGGAAGGACGAT
TTGAACCTGATTTGTATCTCTGGGGGCTCAAATTCAATGGCCTTGCTAGACTTAATGCAC
CAAAGTCTCTTCGGTACTTCTTAAAGAAAAATGTTCTTCCGTGTGCACATCTTTTACGTT
GATGAGGGTAGAGTAGTATATGGATGGGATGAGCAGAAACATCAAGAAAATATTGAATTT
ATCATTAAAACATGCTAGCGTTATGGGTTCACTTATACCATAGTACCTCTGGAGAGCGTT
TATGATATTGGTCTTGGAGTTAACAGCGAAGTTAATGTTGACTTGAAAATGATCGATGCA
GAGATGGCTTAGAAAATTGAAGAGGAAAAGAAATAAGATGAGATTGCACATAGTGTTCCA
GCCAATTAAGAAGAAATTCAGAATTAAATTATGGACTGTCAAGACATTGAGGGTAAAAGA
GAGATGTTAAAGCAATTAATCGAAAGCTTACCCACACATTCTAATTTCAGAGAAGACCTG
ATTTTATATTTAAAGAAATGGGTTATTTCACACTTCGCATTAAAGTACAATTTCAAGAAA
ATTCTTCTAGGTACATCAGGGCATAAGGTTGCAGTATAACTGTTGGCTTAACTTGCCAAG
GGAAGAGGTTCATCAATTGCACATGAAATATCCTACATTGATGATAAGAATTTTGGAGGG
CGAATTACTTTCATGAATCCAATGAGAGAGTTCTTACACAAGGAAATCGCCTTGTTTAAC
TACCTACATAAAGTAGAAATCCTGCTTTAAAAATCCTTAGCTCAATTAAACAACCCCTTT
TCCCATGCTCCAGCTTTCGGTTCAGCTGATATGTTAATTGAGAAATTCTTCGATAAACTC
TAAGACAGATTCAACGTAAATACAGTGCCAACTGTAGTCAAATTAACCAACAAACTCTTA
AAGACTGATTTACTAACACCTTAATAAATAGAATAACAGAAAGTTAATCCCATTGATCAT
TATCCATTCTGTCCTTTGTGTTTTGGAGTCAGAGATGAAATTAATAATCTACTTGAAATG
GGTTCAACTATTAAGAAAATTCATTTGAACCTATAGGATGGTACTTGTCAGGTTGAAGCT
ATCAAGAGTCCCCTAGATTGGTTGAGTGATGAAATGCAACTGGCTTTCTGTTATGGATGT
AAACGTATGGCCATTATGTGTTCGCAAAAAGAGAGGTTTATGCAGCTACTCCCAGATGTA
GTTAAGATAAATTGTCAAAAGACTCTTATCAGCATCTCCAAGCAATAAGAAATGCAAATA
AATCAATAGTGA


>Contig1306.0.g17(protein)
MDIEDLFNEDLNLEEEEKESSHPMIIPEYDPCSGGGNTTDDATQINTSQSNSGAGQCCHG
STCSSGAKSLSSSQILQQTCQNGGCSCTQEQNKQAEDLKVQEEIKAKQADDIKFRCFKCK
KNRANFTNKQDKVCKDCFKEMFVHRFKQSLRSNLKIWKDDLNLICISGGSNSMALLDLMH
QSLFGTSQRKMFFRVHIFYVDEGRVVYGWDEQKHQENIEFIIKTCQRYGFTYTIVPLESV
YDIGLGVNSEVNVDLKMIDAEMAQKIEEEKKQDEIAHSVPANQEEIQNQIMDCQDIEGKR
EMLKQLIESLPTHSNFREDLILYLKKWVISHFALKYNFKKILLGTSGHKVAVQLLAQLAK
GRGSSIAHEISYIDDKNFGGRITFMNPMREFLHKEIALFNYLHKVEILLQKSLAQLNNPF
SHAPAFGSADMLIEKFFDKLQDRFNVNTVPTVVKLTNKLLKTDLLTPQQIEQQKVNPIDH
YPFCPLCFGVRDEINNLLEMGSTIKKIHLNLQDGTCQVEAIKSPLDWLSDEMQLAFCYGC
KRMAIMCSQKERFMQLLPDVVKINCQKTLISISKQQEMQINQQ