Identifiers and Description

Gene Model Identifier

Contig2039.0.g15

Standard Name

CTU1

Aliases

Contig2039_0_g15

Description

PP-loop family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam01171 ) PP-loop family
  • ( pfam10288 ) Protein of unknown function (DUF2392)
  • ( pfam02207 ) Putative zinc finger in N-recognin (UBR box)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005582407.000315720897034e-164conserved hypothetical protein
SGDYGL211W3.001413082154875e-142NCS6 SGDID:S000003179, Chr VII
from 92512-93591, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig2039.0.g15(coding)
ATGAAGTGTGAACTTTGCAACGAGAGAAATGCCAAGATTAAGAGGCCTAAGAACCAAATG
CCTGTTTGTCATGAGTGCTTCTACATGGTATTTGAGGAAGAAATTCATCATACTATCACT
ACCAATACATTATTCAAAAGAGGAGAACGCATAGCTATAGGTGCTAGTGGAGGTAAGGAT
TCAACAGTACTCGCACATGTTATGACTACCTTAAATAAGAGATATGACTATGGCTTAAAC
TTAGAACTTCTCTCAGTAGATGAGGGAATCATAGGTTACAGAGACGACTCTTTAGAAACA
GTAAAGAAAAATTAAATAACTTACGACCTCCCCCTAACAATAGTGTCCTACAAAGACCTC
TATGGCTGGACCATGGACGAAATCGTGAAAGTGATAGGTTTAACAAACAATTGCACATTT
TGTGGAGTATTCAGGAGACAGGCTCTTGACAGAGGAGCTATGTTAATAAAAGCAGATAAG
ATTGTAACTGGGCATAATGCAGATGATATTGCCGAGACAGTCTACATGAATATTCTCAGA
GGAGACTTCTTCAGGCTGCACAAGTGTGTTGATATTATGACTGGCAGGGAGGACGCTCTG
CCAAGATGCAAGCCATTCAAATATACTTATGAGAAGGAAATTGTCATGTATGCTCACTTC
AAGAAACTAGATTATTTCACAACAGAATGCATTTATTCACCAAACGCTTATAGAGGCTAT
GTGCGTGAGTTGATTAAAGACTTGGAGAAAGTTCGCCCCTCAATCATCACAGATATTATT
CACAGTGGTGAGTCGATGAAAATAGACACCTCAAATGTTCAATTTCCCAAGAAAATGAGA
TGCAAGCAATGTGGGTTTGTAGCATCAAATGAACTGTGCAAGGCCTGCATCTTGCTCGAT
GGCTTGAATAAGGGGAAAGCTAGAGTTGCTATTGGAAGAAAGGAATGA


>Contig2039.0.g15(protein)
MKCELCNERNAKIKRPKNQMPVCHECFYMVFEEEIHHTITTNTLFKRGERIAIGASGGKD
STVLAHVMTTLNKRYDYGLNLELLSVDEGIIGYRDDSLETVKKNQITYDLPLTIVSYKDL
YGWTMDEIVKVIGLTNNCTFCGVFRRQALDRGAMLIKADKIVTGHNADDIAETVYMNILR
GDFFRLHKCVDIMTGREDALPRCKPFKYTYEKEIVMYAHFKKLDYFTTECIYSPNAYRGY
VRELIKDLEKVRPSIITDIIHSGESMKIDTSNVQFPKKMRCKQCGFVASNELCKACILLD
GLNKGKARVAIGRKE