Identifiers and Description

Gene Model Identifier

Contig21660.0.g93

Standard Name

CTF18

Aliases

Contig21660_0_g93

Description

Rad17 cell cycle checkpoint protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004836102.9986404383886433e-43ATPase, AAA family protein
SGDYMR078C8.998359040303252e-24CTF18 SGDID:S000004683, Chr XI
II from 424728-422503, Ge...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21660.0.g93(coding)
ATGGAACAGTTAGCAGACAAATTCTACGAAAGCCTTATACTTTCGCAGTACCAGCACAAT
TAGCATGTCATAAAACAAAAGGTAGGACCTTTAGATGAGGGTTTTTGCCAATTTGACTTA
AGAGACCCAGAGCAGTATAGAAAACACTTGTTGACTACTATGCATCACTACCTCCCCAAG
AAAATTCCGCAAGTTAAAATCAAGTTTTATCAGTATTCAAAAGCTGCAAACATAGAGGAA
AAAGTTGAGGAGGAATTTCAATATGCAGCTGAGTATTTTCAGGCCGAGGAGTTTCAGTAA
TATATGAGCGAATAGTTGAACAATAAAAAGACTCACTTGCTAGATAATGACATGGAGACA
ATTTTCACCAATATCAACAATAAAAAGGAATAGTAGGAGAGAGTGAGACAAGTTAGAATT
GAAAATGAGTTGAAGAAGCAGAGAGAATTTGAAGATGATATGGGATTGGAATTCGACGAT
AATGGAGATATAATTAATCACAAAGATATGGAGAGCAAGCTAGAATCGAAATAAAGACAT
CAGATCAATTAACTTTGGATTGACAAGTACACTTCTTAGAAATTCTTTGAGTTGCTGACT
GATGAAGCTACAAATAGAAATGTTCTTACTTGGATTAAAACTTGGGATGAAGTTGTTTAT
CCAGAGGCTCCCATTGTGAACTTGAAAGTGCCACTATCCATGCAAAAGTAGTATGTCCAT
TCTGGTCTCCAAGCTGTCAATGGCGTGCCTCAGAGGGCTCCTACACATCACTTCGTTTAA
CATTAAGATTAGTTTAGTTTCAAGAACAAGAAAGTCTTGCTGCTCTACGGTCCTCCAGGC
ACAGGCAAATCAACTATGGCTAGAGTCCTCGCAAAACATTGTGGGTACAATATAACTGAG
GTCAATGCTTCAGATGAGAGAACTGGCGATAGACTTTTGGAGAAGATCAAGAGTGCTACT
CAAATGAACTCACATTTCTCAAAAGCAGCTCCTTCACCTGTAAATGGTGGTAACCAAGAT
GACAAATAGAAACCTGTTTGCTTGATAGTAGATGAAGTTGATGGCGCAGTAGGTAGTGGA
GGAAGCTTAGATGGACAGAAGGGTGTCGGAAAGATTGTTGAGTACCTTAAGAAATGCATC
AACTACTCAGAAAATTTAGCAAAGAAAAGAAACCAGGCAGATGAAGACGATGAAGGTGAT
GAAGACATGAAAGATCAAGACGATAACGATCAAGAAGAAGGTGCTAGTAAAATAGCTAAA
AAAGCAGGAAAAAAGAAGAAGGATGATGGCATTCGTGAGTTGAAAAGACCAATAATATTC
ATTTGCAATGACCTTTACTCCAAAGCTCTGATGCCATTAAGAGATATTGCTTTATGTGTT
AAAATTGAAGAATCTAACTATGAAAGATTATTACAAAGATTGAGATTCATTTGCAAGAAG
GAAAATTTCAAAGTTGATGACTAAATTCTAAGAGAACTGTGTGAAGAGACTAGATTTGAC
GCTAGAAGTTGCATTAACACTCTTCAATTTATGGCTGCTTAACAGAGAGAGAATGGAGAA
AAAATTACAGTAAATTAGGCAGTTGAGACTTGTGGGAAAATGACTTATGGGAAGGACAAT
TTTGATAATGTGTTTAATATTGCAGATGAACTGCTATTTTGCAAAGACAGACACATCTAC
ACTAACAATGTGAAATTGCTTAAGGAAGTCAGGCAAAAGGTTTAAGTACTCGGCGACAGT
TAACTATTAAACGACTATCTATTCCATAATTATAGTAGCAGCGTTGGGTATTTTGATGAT
GATCTCGAAAAAACAGCATACTTTTTAGACACAATGTCTAGAGCAGAGCTGAATCAATCT
TTCATAGGTAGAACTTAGAATTATGAAATGCTGTCTACTTAGTATATCCCAGCATATACA
TTTAGAAAGTTTTGTGCTGGAGTAAGAATAAGTAAAAATGAATTCCCAAAGGAAGTGAGA
AACTTCAGATTTGAAAGGCAAAAATATAAGGACACTTTTGATAAGCTTCTAGACTTATCA
GGAGGTAAGTCTCAAAGAAAAGGTTTTAGAAAATTGAAGGAGAACGACGTGAATAACGAG
GAGAGATTTAAACTTGATAAAAATACTTCTCTATAAACAGGAATCAGAAAAAGAGACTTT
AACACTGATATTCTTCCATTCATATATCACATGGTTCATCCAAATATAAGAGAAATAAAC
ACTTAGTTATTTACTAAGCATGAGAGAATAGCTTTTCAATAAGCAATAGAAATAATGATA
ATGTTTGACATCACTCTTAAGCCTGAATCTCAGGACTCTCTGCTTGACCTATCAAATTAT
AATGCAGATATTGCCTAGTTTGAACCAGACCTCACTTCGCTTGTGACTTTCAAGGGAGGC
CACAAGTAGTACATGAGAAACAAAACTCAAATACTCGTGCTTTAAAACTACGAAAGCATT
AAGCAAAGAATGTTAACTTCCTCAAACGGGCAATTAGGCGACTATTTTGAAACATTGAAA
CTTAAAAAATCAGCTGCAATTGAAGATACTAAACTATCTGGTTTTGGATTTTTGGCAGGT
ATCGCAGCTCAGACTTAATAAAATTAAAAGAAAAGAAAACTTGATCAAATATCAGGGGCT
CGCAGTAACTAAAATAACGCTGAAAATGCTATTTCGGAATAAAATCAACAATAGTAATAA
GAAAGTACAGGCAGATTTACTTATAAATTTAAAGAAGGGCATTCCAAGAATTTCAAGAGA
GAATTAAACTTTGATTACTTCACCGCTTGA


>Contig21660.0.g93(protein)
MEQLADKFYESLILSQYQHNQHVIKQKVGPLDEGFCQFDLRDPEQYRKHLLTTMHHYLPK
KIPQVKIKFYQYSKAANIEEKVEEEFQYAAEYFQAEEFQQYMSEQLNNKKTHLLDNDMET
IFTNINNKKEQQERVRQVRIENELKKQREFEDDMGLEFDDNGDIINHKDMESKLESKQRH
QINQLWIDKYTSQKFFELLTDEATNRNVLTWIKTWDEVVYPEAPIVNLKVPLSMQKQYVH
SGLQAVNGVPQRAPTHHFVQHQDQFSFKNKKVLLLYGPPGTGKSTMARVLAKHCGYNITE
VNASDERTGDRLLEKIKSATQMNSHFSKAAPSPVNGGNQDDKQKPVCLIVDEVDGAVGSG
GSLDGQKGVGKIVEYLKKCINYSENLAKKRNQADEDDEGDEDMKDQDDNDQEEGASKIAK
KAGKKKKDDGIRELKRPIIFICNDLYSKALMPLRDIALCVKIEESNYERLLQRLRFICKK
ENFKVDDQILRELCEETRFDARSCINTLQFMAAQQRENGEKITVNQAVETCGKMTYGKDN
FDNVFNIADELLFCKDRHIYTNNVKLLKEVRQKVQVLGDSQLLNDYLFHNYSSSVGYFDD
DLEKTAYFLDTMSRAELNQSFIGRTQNYEMLSTQYIPAYTFRKFCAGVRISKNEFPKEVR
NFRFERQKYKDTFDKLLDLSGGKSQRKGFRKLKENDVNNEERFKLDKNTSLQTGIRKRDF
NTDILPFIYHMVHPNIREINTQLFTKHERIAFQQAIEIMIMFDITLKPESQDSLLDLSNY
NADIAQFEPDLTSLVTFKGGHKQYMRNKTQILVLQNYESIKQRMLTSSNGQLGDYFETLK
LKKSAAIEDTKLSGFGFLAGIAAQTQQNQKKRKLDQISGARSNQNNAENAISEQNQQQQQ
ESTGRFTYKFKEGHSKNFKRELNFDYFTA