Identifiers and Description

Gene Model Identifier

Contig401.1.g83

Standard Name

CSTF2

Aliases

Contig401_1_g83

Description

RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYGL044C0.00000000000020009182674645818RNA15 SGDID:S000003012, Chr VI
I from 417036-416146, Gen...
T. thermophilaTTHERM_003534400.00000030014504373857585hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig401.1.g83(coding)
ATGAATCCCATGATGAATCAATATGGTAAAACCACACCTTAACCTCAAGCTTACGGTGGT
CATTAACAACAATAACAGTAGTAGCATCAAATTGTTGGGGGGTAGAGCATGGGTGCTATA
TAAAACCCTGGAGTAACCCCTGTTGGTTAATAATAATAATTGGTAATGAATGAGAATATG
TGTTTGTATAGTACTGAGGTCTCTAAAAATCCATCTTGTATATTTTTCGGTAATATACCA
TATGATGCAACTGAGTAGGACTTGAGGGAGACATTGAATCTAGCAGGTCCGTTTATGGAA
TTCAGACTTAAAACTGACCCTAAAACCAATCAGCCCAAGGGTTTCGGGTTTTGTGAATAT
AGAGACCCTGATATCGCAGCTTGTGCTTTGAGAAATTTGAATAAATCTGAAATTAATGGT
AGAAATCTAAAGGTAGATTTCGCATCAGATAATAAAAACGGAACTAACCTCAAAGAAGAG
GATGTCAAGTTTAGAGATAGAGGAGAAATGGTTACTCTTAAGGGGGAATACTTGAATGAT
CATGAATCATCAGTAGAGGAAATTTTAAATTCATTGTCTACAGATTAAGAGCAACTTTTA
CTTTTTGGCATTAAAGATATCTACGATTAGATGGCTAGAGAAAACCCTCGTTTATGTGAG
CAAATGATTGAGAATTTGGCATAAGACGAATCCCTTCTGGATAATTTGACTGGCATGCTT
GAGAGAGTACAAGCTCTGCATGGAGGGCCATAGTTCATGTCTCAAGGAGGTATCTACCAT
TACAGTAGTGGCAATCAAGGTGCTCCAGGAGGTATGGGTGGAATGAATCCACATGGCTAT
CAAAACTACTATTAATGA


>Contig401.1.g83(protein)
MNPMMNQYGKTTPQPQAYGGHQQQQQQQHQIVGGQSMGAIQNPGVTPVGQQQQLVMNENM
CLYSTEVSKNPSCIFFGNIPYDATEQDLRETLNLAGPFMEFRLKTDPKTNQPKGFGFCEY
RDPDIAACALRNLNKSEINGRNLKVDFASDNKNGTNLKEEDVKFRDRGEMVTLKGEYLND
HESSVEEILNSLSTDQEQLLLFGIKDIYDQMARENPRLCEQMIENLAQDESLLDNLTGML
ERVQALHGGPQFMSQGGIYHYSSGNQGAPGGMGGMNPHGYQNYYQ