Identifiers and Description

Gene Model Identifier

Contig1140.1.g131

Standard Name

CSNK1G2o

Aliases

Contig1140_1_g131

Description

Protein kinase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_012139604.000347951747671e-122Protein kinase domain containi
ng protein
SGDYPL204W3.0004885828297914e-109HRR25 SGDID:S000006125, Chr XV
I from 164276-165760, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1140.1.g131(coding)
ATGCATTCATTCGAAAATTATAGAAAGAAAAGCTTCTCGGAGATGATAGATTAACTCAAT
AAATCTGATGATGCTTAAGCCCAATCATAGTCTTAATCTCCTGTTAAAGCACCAGACACT
AGATAAATAGTAGTTAAATCTACATAGCAAAGTAATGAGGACAAAAACTAAGAAGCACTA
AACTTGCTAGAGTAGTAATTGAAATAAATGAAATTAGATTAGAAAAGAAATAAGCAAGAG
CAATATAAAAAAGAATAGCTCAAGCGAGATGCTTCGAAATCTTTACTAAATGCCGGTTCA
ATCTCTTAATTAGGCTCTACGATTAATTTAAATGGGACTATGAAATCTGGGTTAAGAAAG
TTGGATAACTCAAGCAAAGTTAGTACAAGAGCTTTAAACCAGGATTTTAGCTTAAATATG
TAAAACAGCTCAAGTTTGATGGATTAAACTTAGAAAGACTTGCTAATCTAGACAAAAAAT
AAAAAGAATGAAGTTGATTAAGATACAAAGGAGAGTCTAAGAAAGAACAAGTAAAAGTTT
TAGATAAAAGATAAAAATTTTAAACTAAACATCTTTGAAAAAGCTCTTGAGTAAAAGGAT
TTATCTAAAGAACAGCAATAGCTTTTGAAAGAGTAAATGAATCAAAAGCCAATAACAAAA
CGAATACGAAATAAAGATTACGTTGATAAGGAATTTTTGAATCAAATCAGATATCAGAGA
ATCCAAGAAATAAAAAAATATAAGAAGTCACATTTAGACTTGGTATCTAGATTGAAAGGG
ATTACAGACAGAAGGAAAGTAGAGAAGTTTGAGAGTTTAGATACAGTAGTTGTTGACCCT
TTTGAGACAAAGCAGAACTCCAGAATTCTGCAATTTTTAATCTATGACATGAACACTTTT
CAAAAATTGCTGGAGGAACACGGAATTGAGGAAAAAATTATTGATGAAAGAGAGGCTAAT
CAAGCGGAACTTATAATGGACAAAATTGAAGAAGAGGAGAAAAATTTGGAAAGAGAAATT
GAACTCAGAAGCAAAATAAAAGATAAATATGTTGGTGGAAAAGGAGTCAAAAAGATAACA
ATGGAAGATAAAAGTTGGTTTGATATGACAAAAGACAATTCCATAAGAATCTAAGAAATC
CTTAATGAAATTCAAGCCAAATCCGACAAATTTTATAAGCTCAACAATTAATGGGTCTCA
AGATTCCTAGAACTTATAGAAACTCATAAACCTAACATTAGACTGAGATTTGATCCTTAT
GCTAAACTCTAATCCCGACAAGACTTGAGTTCAATGCTTTAGATAAATGAACAAGATTTT
CACAGATAAACCCTCAAAGATATAGTTTAGCAAAACACTGATAACACAGCCCAACTCTCC
CACTAATTAAGCAAAAACTAGATATTCGTTACAGTTTAATAAGACCAGGAGGCTTTAACT
TCATTGAATAAAAATACTGGTAAAGTGAGTCAGCAATATTTAGATCCTTATTATCTACCC
ACTCCTTAAAGTAATAAGTCATTTATGAATATCAAGTCACAGCTGACTTTAAATAGTGTG
GGTAATAATATTAATCGGAATGGCAGTAGCGCTTTTGTAGATTAGGATTTCCTACAAACT
AATGTTATTCATAAATATCTCACGCAAGGTAGAGGAAAGTCAATGGATAAAATACAGAGA
TTTTACTAGTTAAAAGATATCTTGGGAAAATGCAATGAAAACCTAAATATAGATAGGGAA
AACAATAAATATTCAATTTTATTAAGAAAAATGGAAGATATGGTTTAGGCCTAGAAAATT
CATAGAAATCCCAGTGAAATGTTAAGTGATTATCAAACACAGTCAGTGGGTAGGAAATTG
GGGGCTGGTTCTTTCGGCTCTATTTTACTGGGTACTGATATAGACAATGGAAAATATGTC
GCAATTAAATTTGAAAAATCATCATTAAACAAGCAGCCCTAACTTCCATACGAAGCCAAA
GTTATGCGTAATTTATCTCAAGGGAACAATCCAGTCTTTGGTGTGCCTAAAATTCACTGG
CTTGCTATGGAGAGTGAGTTCAATATCATGGTGATGGATTTATTGGGACCTAGTTTAGCA
GATCTCTTCAACTACTGTAGCAAGAAATTCTCACTTAAAACCACGCTAATGCTTGCTGAC
TAAATGTTGCAAAGAATTGAATAGATTCATAAGAAAAACTACATTCATAGAGATATAAAA
CCTGATAATTTCTTAATGGGATTAGGGACTGAGTCATACATTGTAAATGTTATAGATTTT
GGACTGTCCAAGAAATTTAGAGATGCAAAATCTTAGCAACATATTCCTTATAGAGAAAAC
AGAAACTTGACAGGTACAGCTAGATATGCTTCGTTAAATGCTCATTTGGGCATTGAATAA
AGTCGAAGAGACGATTTGGAAGCTATTGGCTTTTGTTTGATATATTTCATATAAGGAAAG
TTGCCTTGGTAAAATCTCCAAGCTAACAATCGTGCAGAACGCTATGCAAAGATAGCTGAG
ATTAAGTTGCGATCTCCTGTTGAGCATATCTGTTTGGACTTACCCCTAGAAATAGCAAAT
TACATGCATTACGTAAGAGCCCTAAGATTCGAGGATCGCCCTGATTACCAAGGAATCCGA
CATTTCTTCAAAAAATTACTTGTAAAAGAGGGTTACGAGTACGATCATCTCTACGATTGG
GTGATGATAAACAACCAGCACCTTGAAAACATATTCACAGTGGAGAGCTTCGATGATTTG
AGGCAGAGGAGCGATCGAAACAAAAACCTCAAGACTGAGAGTGTGGAGGGGTAGAAGGAC
TAAGAGGATAAAGAAGAGGAAGAGGAACTGAAGGAGGATGATGCAGAGAATAATAAAACT
GATCAAGATGATGCAACGGACTAAGATCCCGATGTATCCCCCACTAAACTGCACAACGAC
AGCACCAACATCACCCACATAGGCGACCCAAACCAACACCTCCTACACAATCCAAACGAC
GACGAAAACAAGAATCTGAATGACTCAAGTCTGATCACCAACAACGCTGTGCATGAGGAG
TCAAACCTAATCAAAACTCAGGCAAAAAGTCAGCCACAGGAGGAGAAAACTAGTAAAACA
CTGATGAATAGGCTGGGCATCAATGAGAATATCAAGCCGCAGAAGAAGTTTCTCATGGTT
AATTAGCAATAGAATAAAAATGATGGGAAAAGTGATAGAGATAATAAAAATGATAAACAT
GCAAAGGGATAGAAAGGGAAGCATCACAAAAAGAAACATAATAAGGGTGATGATGATGAG
AAATGTATTATCTACTGA


>Contig1140.1.g131(protein)
MHSFENYRKKSFSEMIDQLNKSDDAQAQSQSQSPVKAPDTRQIVVKSTQQSNEDKNQEAL
NLLEQQLKQMKLDQKRNKQEQYKKEQLKRDASKSLLNAGSISQLGSTINLNGTMKSGLRK
LDNSSKVSTRALNQDFSLNMQNSSSLMDQTQKDLLIQTKNKKNEVDQDTKESLRKNKQKF
QIKDKNFKLNIFEKALEQKDLSKEQQQLLKEQMNQKPITKRIRNKDYVDKEFLNQIRYQR
IQEIKKYKKSHLDLVSRLKGITDRRKVEKFESLDTVVVDPFETKQNSRILQFLIYDMNTF
QKLLEEHGIEEKIIDEREANQAELIMDKIEEEEKNLEREIELRSKIKDKYVGGKGVKKIT
MEDKSWFDMTKDNSIRIQEILNEIQAKSDKFYKLNNQWVSRFLELIETHKPNIRLRFDPY
AKLQSRQDLSSMLQINEQDFHRQTLKDIVQQNTDNTAQLSHQLSKNQIFVTVQQDQEALT
SLNKNTGKVSQQYLDPYYLPTPQSNKSFMNIKSQLTLNSVGNNINRNGSSAFVDQDFLQT
NVIHKYLTQGRGKSMDKIQRFYQLKDILGKCNENLNIDRENNKYSILLRKMEDMVQAQKI
HRNPSEMLSDYQTQSVGRKLGAGSFGSILLGTDIDNGKYVAIKFEKSSLNKQPQLPYEAK
VMRNLSQGNNPVFGVPKIHWLAMESEFNIMVMDLLGPSLADLFNYCSKKFSLKTTLMLAD
QMLQRIEQIHKKNYIHRDIKPDNFLMGLGTESYIVNVIDFGLSKKFRDAKSQQHIPYREN
RNLTGTARYASLNAHLGIEQSRRDDLEAIGFCLIYFIQGKLPWQNLQANNRAERYAKIAE
IKLRSPVEHICLDLPLEIANYMHYVRALRFEDRPDYQGIRHFFKKLLVKEGYEYDHLYDW
VMINNQHLENIFTVESFDDLRQRSDRNKNLKTESVEGQKDQEDKEEEEELKEDDAENNKT
DQDDATDQDPDVSPTKLHNDSTNITHIGDPNQHLLHNPNDDENKNLNDSSLITNNAVHEE
SNLIKTQAKSQPQEEKTSKTLMNRLGINENIKPQKKFLMVNQQQNKNDGKSDRDNKNDKH
AKGQKGKHHKKKHNKGDDDEKCIIY