Identifiers and Description

Gene Model Identifier

Contig10909.0.g24

Standard Name

CSM3

Aliases

Contig10909_0_g24

Description

Replication Fork Protection Component Swi3

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( pfam07962 ) Replication Fork Protection Component Swi3
  • ( pfam11240 ) Protein of unknown function (DUF3042)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006701600.0000000000599805963605737hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10909.0.g24(coding)
ATGAATATTACAGACCAATCAGCAAACAACAAAACTTAAAATAAACCAGCTTCTAGCAAT
CCATTTAATTTTGATGATGAATTCAATAACGCAGAGGAAGTGCAGCTAGACGAGAACGGC
ATCCCCATTCCAGTTGCAAGCAAAGAGGATGATAAAAAAAAGAAAGTGAAGAGGCAGCAG
TTGAAGTTTGATGCCAGTTATTTGATTGATAATCCAGTTGGATTGAAGACTTTGTATAAG
CAGCTTGTAGTGGAGAAACAAAAGAATTGCAATTTCAAGGGACAAGGGCATGAAGTCAGT
GATTTGAGAAGGTTGATGGGCGTTTATAAGGCATGGCATTTTAATGCCATGCCCAAGTTT
GAAATGGGATACTTTGCTGAAAGATTGCAAAAGGTAGGCACTGATAAGGCAATGAAAGGA
TTTATGACGAAGTTGAGAAATCATTATAAGGGAGTGACTCCAATCGAGGAATTTGAAGAT
CTTGAGAAGAAACCTGAAATAAAGGGTACCAGCTCAAAGGGAGAGGATAATAAAAATGCC
TTTGAGTACATCAACACTTCAACTAACAACAATAATTACTACGATGATTATTACGATCAT
TAATCAAAGACTCAGTAATCACAATCTAAGACTGATTAGAAACCATACTTCAAACTTTTA
GACACTACAACTAATGGCACTACTAATCAAGATAACAATGTGAGATTTTCACTCCCCACT
GTAACCACTCAAGTGAAGCAAATTTAGGAATTAACTGAAGAATAGCTTAAGGCAATCGAA
GAAAATCGCAAAAAGGCTTAAGAACGTAAACGTAAGAGGGAAGAAACCATGCAAAAGTCT
AACTACGATGAATATGATTAGTACTACGAGGAGTACTAGAACCAATAGCACAACAATGGT
CACTAAGATCAAGTGATGCAAGACCACTCTAAAATAAATCAGAACTAGACTTTGCAGTAA
GATATCACTTAGGAACCAACTAATGGAAAGAGACTGTAGACCGATTCAAATACTCACTAC
AAACTGAAGCAGGAAAATTCATAGCAAAATGGTGGCAATGGCGATAACTTTGGATTTAAG
ATGGTCTATGACGGGGACGATATTGATGATCAAATTGATTTGAATATAAACGAGCTGGAG
GATTGTCTTGATGATCAAGTTGAAAAGATTCAAAGTCAAATCGACAATGGAGGATTCGAT
AGAAAGCTTGAATAAGATGAAGAAGGATTCTATGAATATAACTGA


>Contig10909.0.g24(protein)
MNITDQSANNKTQNKPASSNPFNFDDEFNNAEEVQLDENGIPIPVASKEDDKKKKVKRQQ
LKFDASYLIDNPVGLKTLYKQLVVEKQKNCNFKGQGHEVSDLRRLMGVYKAWHFNAMPKF
EMGYFAERLQKVGTDKAMKGFMTKLRNHYKGVTPIEEFEDLEKKPEIKGTSSKGEDNKNA
FEYINTSTNNNNYYDDYYDHQSKTQQSQSKTDQKPYFKLLDTTTNGTTNQDNNVRFSLPT
VTTQVKQIQELTEEQLKAIEENRKKAQERKRKREETMQKSNYDEYDQYYEEYQNQQHNNG
HQDQVMQDHSKINQNQTLQQDITQEPTNGKRLQTDSNTHYKLKQENSQQNGGNGDNFGFK
MVYDGDDIDDQIDLNINELEDCLDDQVEKIQSQIDNGGFDRKLEQDEEGFYEYN