Identifiers and Description

Gene Model Identifier

Contig21513.0.g33

Standard Name

CSL4a

Aliases

Contig21513_0_g33

Description

Exosome component EXOSC1/CSL4

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam10447 ) Exosome component EXOSC1/CSL4
  • ( pfam14382 ) Exosome complex exonuclease RRP4 N-terminal region
  • ( pfam01938 ) TRAM domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003549909.001422350855153e-28hypothetical protein
SGDYNL232W6.998542127613979e-20CSL4 SGDID:S000005176, Chr XIV
from 214923-215801, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21513.0.g33(coding)
ATGGAGAAAGTTCACGCAGGCAAGCTGCTAGGTTCAACTGAAGACTGTATCAGCGGAAAG
GGTACATATACCTATCTAAAGGGAGTGTACGCTTCTCAAACTGGTTTTGTTAACATTGAC
AAATCTCAAGGAGATAAATCTATAATCAGTGTAGAGAGAACAAATTAATCAGAAAAGAAA
AATGATAGCTCATAGTAAACTCAATCCAACATAGAAAGCAATGTATTTGGACAACCTAAA
ATTGGAAATTTAGTGTATGCCAGAATCACAAGAGTTGAACCAAACTTTGTGAAAGCGGAA
ATCTTAGCTATTGAAAATTAGCCACTTAAAACTGTCTTCTAGGGCATTTTGTTTAAAGAA
AACGTGAGAACATACGATATTGATAATCTAGAATTATTGAAGTGCTTTAGACCTAATGAC
ATAATAAGAGCTAGAGTCATATCTGAGTAAGGAGCAGGTAATTAAATGTCAACTCTCCTC
TCCACAGTTGAAGATGAAAATGGCGTAGTTTTCGCAAGAAGTGAAAACAGTGGTGCATTG
ATGATTCCCTGTACTTGGAATGATTTTATGTGCGTCAAGAGCAAGAAGAAGGAGAAGAGA
AAGGTAGCTAAGCCAGATGTTATTGGGAATAGTAATAACGAGGAAGGGAGTGAAGCTATG
CAAATTGATTAATGA


>Contig21513.0.g33(protein)
MEKVHAGKLLGSTEDCISGKGTYTYLKGVYASQTGFVNIDKSQGDKSIISVERTNQSEKK
NDSSQQTQSNIESNVFGQPKIGNLVYARITRVEPNFVKAEILAIENQPLKTVFQGILFKE
NVRTYDIDNLELLKCFRPNDIIRARVISEQGAGNQMSTLLSTVEDENGVVFARSENSGAL
MIPCTWNDFMCVKSKKKEKRKVAKPDVIGNSNNEEGSEAMQIDQ