Identifiers and Description

Gene Model Identifier

Contig17808.0.g96

Standard Name

CRY1c

Aliases

Contig17808_0_g96

Description

FAD binding domain of DNA photolyase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002954101.000137892321693e-31FAD binding domain of DNA phot
olyase family p...
SGDYOR386W7.000402845995459e-29PHR1 SGDID:S000005913, Chr XV
from 1066839-1068536, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17808.0.g96(coding)
ATGGAAAGCAGGTCAATGAAATACAAGCCCAAAAATCAGCAATAGAATCTTCAGCAATCT
ACTTAAAGTTAAGTCAACTGGGGAGATATGGACAAAATGTTTACAAGGAAAGTGACAAAG
ATCGATTATAAAGAAGAAGAAATCAAGGCAAGTGATATTAAGAGTTCAGTATAAGAGGAA
GTTAAAAATCAAAGTTCTAATAATAAAATGCAAAGAATTATCTTGTGGTTCCGTAACGAT
TTGAGGTTACACGATAATGCAATAATAAATTACGCAGTTAAGCACTCTGCCCCTAATAAA
TAAATAGTCCCTGTCTTTTGTTACGACCCCCGCTTCCACGCTAAGAAGGTTTAGTAATTT
GGAACTTAGAAATGCGGGCTGGTGAGACAAAGGTTCTTAATAGAGACAGTAGAAAATTTT
AGACATAATTTAGAGAAGATGGGAAGTAAGCTTTTAGTGTCAATGGAAAGGCCTGAAGAG
TTTATTCCCAAGCTTATTGATTAAGAGTGTGATAATACTATTGTCTACTAAGATGAGATA
TGTAGTGAAGAGATGGCAGTGGAAAGAGCTGTGTAAAAGAGTTGCAAGGGTGCAAATGTG
AAAACATTCTGGGGATCATCGGTCTATCATGTTGATGATCTTGGCTTTGAAATAGATCAT
CTCCCTTAAGTCTATACGAAATTTAGAGAAGTTTGTGGAAGAGTTCCAGTCAGGTCACTT
TTTCCTAATCCAAAGAATGGGGATCTACCATTCATAGAAAACCCTTCAGATATCATGACT
AAAGCTACTATTTTTAGTCCATAGCTTGAAGATTTTGGATTTACAAAAGAACAGATAGCT
TTGGGTAAAGATAAAAGGTCAGTAATTGAATTTATTGGTGGAGAAGATGCTGCTCTTAAA
CGATTTAAAGAGTATGTTTATGAAACTTAAGCAGTAAGTCATTATGCTGACACTAGAAAT
GAATTGCTTGGTGAGAACGTGTCATCTAGATTCAGCCCTTGGATGGCTCATGGATCTCTA
TCACCAAGATATATTTATCATAAAGTCAAAGAATACGAAAGTAAAAACCAATTGACAGAG
AAATCAACTAAAAAGTTAATAGATGAGGTATTTTGGAGAGATTGGTGCAGATTTTGGGCT
TTGAAATATGGGAACAATATCTTCGGAGTGTATGGCTTTGATTACGAAAGAGGTTCAAAG
AGGTATTAGTGGACTACAAATCCTGAGATAGTAAGAAGATGGAGATAAGGGACAACTGGC
ATGCCATTGATTGATGCTTTTATGAGAGAATTGAACTTTGGTGGATTCATGTCAAATAGA
GGTCGTTAAATAGTTGCAAGTTACTTAGTTCTTGACTTGAATTAGGACTGGAGATTTGGT
GCCCATCATTTCGAAGAAAAGCTTATAGATCATGATGTACATAGTAACTATGCGAGTTGG
AACTTTGCTGCAGGGATTGGGCCAAGCAAAGTGCTTTAATTCAATGTCCAAAAGTAGTCA
AGAGATCATGATAAAAATGGAGAATTTATCAAGACTTGGGTTCCTGAATTGAGAAATGTG
CCGCTTGAATATATTCATGAGCCGTGGACTATGTCTTCTATGGTTCAGGAAGAATGTGGT
GTTATTATTGGGAAGGATTATCCTAAGCCCATTTAGTCTAGATACACTTAAAATTAAGTA
AAAAGTCAAGGAAGTTATGCTTAAAATTATTAGAAAAATAATAATAATTAAAAAGGTAAC
TAGCAATAATAAGCAAAGAAAGTTTATCAAAAAAAGTATTGA


>Contig17808.0.g96(protein)
MESRSMKYKPKNQQQNLQQSTQSQVNWGDMDKMFTRKVTKIDYKEEEIKASDIKSSVQEE
VKNQSSNNKMQRIILWFRNDLRLHDNAIINYAVKHSAPNKQIVPVFCYDPRFHAKKVQQF
GTQKCGLVRQRFLIETVENFRHNLEKMGSKLLVSMERPEEFIPKLIDQECDNTIVYQDEI
CSEEMAVERAVQKSCKGANVKTFWGSSVYHVDDLGFEIDHLPQVYTKFREVCGRVPVRSL
FPNPKNGDLPFIENPSDIMTKATIFSPQLEDFGFTKEQIALGKDKRSVIEFIGGEDAALK
RFKEYVYETQAVSHYADTRNELLGENVSSRFSPWMAHGSLSPRYIYHKVKEYESKNQLTE
KSTKKLIDEVFWRDWCRFWALKYGNNIFGVYGFDYERGSKRYQWTTNPEIVRRWRQGTTG
MPLIDAFMRELNFGGFMSNRGRQIVASYLVLDLNQDWRFGAHHFEEKLIDHDVHSNYASW
NFAAGIGPSKVLQFNVQKQSRDHDKNGEFIKTWVPELRNVPLEYIHEPWTMSSMVQEECG
VIIGKDYPKPIQSRYTQNQVKSQGSYAQNYQKNNNNQKGNQQQQAKKVYQKKY