Identifiers and Description

Gene Model Identifier

Contig4138.0.g37

Standard Name

CRY1b

Aliases

Contig4138_0_g37

Description

FAD binding domain of DNA photolyase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000467304.999350823993609e-33FAD binding domain of DNA phot
olyase family p...
SGDYOR386W2.9992476920535046e-16PHR1 SGDID:S000005913, Chr XV
from 1066839-1068536, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4138.0.g37(coding)
ATGGAGGCTCTATCTAAGAAATTGAATATTTATTGGTTCAGGAAAGCATTACGTCTTCAT
GACAACAAAGGCTTAATCGATTCTTCCTCTACATGCACCAATCTTTTGCCAATTTTTATA
TTGGATCCTTGGTTTGTAAAAAATGAGGAAAAAGTTGGCACTAACAGAATGAAATTCTTG
ATTGATTCTCTTATTGATCTAAATAAATCACTCTAGAAGGAGTATGACAGCAATTTAGTC
ATTTTATATGGATAACCTGCTGAGATATTTGAGAAACTAGCCCATGAAAGTGAAAAACTA
TACTTTGAGTTAGACACAGAGCCATATGCCCAAGATAGAGATAGAAAAGTGGTTTAAATT
TGTGAGAAAGCAGGTGTGTAAGTTCACAGAAACACTGGTCATACTCTTCTTAAACTCTCT
GATCTTGCAGATGCAGGAGAGACTTGTAAGAACTACGGAGACTTCCAAAAGTTCATGCGA
GACAAAAAGATAGAAAGCCCTTTGGACAAACCAAAAGAGCTACCTCAGTTACCAAACAAC
TATGAAAAACTTTTGAAACACCTTAAAATAGAATACTCAAATGATGTGCCATCAATTTCC
GACTTGGATAGAAATGAAAAAGATGTGACCACACACTTTATAGGAGGAGAAACTAAAGCT
CTTGAAATTATGGAGGAGTATATAAAAGACAAGAGAAGAGTAAATTCTTTCTCTAAACCA
TTCACATCTCCAAATTCTTTAAAGCCCAGTACTACTGCCTTGAGTCCTTACCTGAAATTT
GGATGCTTATCTATTAGATTATTCCACGAAAAAGTTAAATCAGTTTTGCGAAGTGATTGT
ACACAACCACCTGTCTCTTTGATTGGTTAAATCTACTGGCGTGAGTTTTTTTATGCCAAA
TCCTATACGGTTAAGAATTTTCATTTTATGCAAGGCAATCCTCTTTGCAAACAAATCAAT
TGGAACAAAGACGAAGAGATAATTAAAAAATGGGAAATGGGCTAAACTGGATTCCCAGCT
ATTGATGCTGTTATGAATCAATTAAGATAAGAAGGGTGGATGCACCACTTAGCCAGACAT
CTAGTTGCTTGTTTTCTGACAAGAGGACATTTATATTAACATTGGGAGAGAGGAAGAGAC
GTATTTGACAAATATCTGCTTGACGCTGATTATGCACTTAATAATGCAAATTGGATGTGG
TTGTCTTGTTCAGCATTTTTTTCTTAATACTGGAAAGTATACTCCCCAGTCAGTTTCTTT
TAGAAAACAGATAAGAACGGTGATTTTATAAGAAAGTACGTTCCAGCTCTCAAACATTTT
CCCTCTGAATACATTTATGAACCAAGTAAGGCTCCAGTTGCTGTGTAAAAAAGAGCAAAA
TGCATAATTGGGGAAGACTACCCATTTCCTATCGTTGACTATAAAGCAGAGCAAGCTCTA
AATATAAACAAATTGAAGATTATTTTCGCATAAAGTAAGGATCTAAATTCAAAGAACAAT
TCAAGTTAAAAGATCGTCAAGAAAGTTCTGACATCATCATAGTCAAACAATAAAAGTAAA
TAAAATGATGATTATGACAGTGAGAGTGATGGCATAAAATAAGCTAAAGACACCTAGGTT
GATAATGACGAAGATTATGCAGAAAAAAGCATGCCTAAGGGCAGAAAGACACCTTAAAAG
AAGACTCCCAATATGATTAAAAGTTAAAAATGA


>Contig4138.0.g37(protein)
MEALSKKLNIYWFRKALRLHDNKGLIDSSSTCTNLLPIFILDPWFVKNEEKVGTNRMKFL
IDSLIDLNKSLQKEYDSNLVILYGQPAEIFEKLAHESEKLYFELDTEPYAQDRDRKVVQI
CEKAGVQVHRNTGHTLLKLSDLADAGETCKNYGDFQKFMRDKKIESPLDKPKELPQLPNN
YEKLLKHLKIEYSNDVPSISDLDRNEKDVTTHFIGGETKALEIMEEYIKDKRRVNSFSKP
FTSPNSLKPSTTALSPYLKFGCLSIRLFHEKVKSVLRSDCTQPPVSLIGQIYWREFFYAK
SYTVKNFHFMQGNPLCKQINWNKDEEIIKKWEMGQTGFPAIDAVMNQLRQEGWMHHLARH
LVACFLTRGHLYQHWERGRDVFDKYLLDADYALNNANWMWLSCSAFFSQYWKVYSPVSFF
QKTDKNGDFIRKYVPALKHFPSEYIYEPSKAPVAVQKRAKCIIGEDYPFPIVDYKAEQAL
NINKLKIIFAQSKDLNSKNNSSQKIVKKVLTSSQSNNKSKQNDDYDSESDGIKQAKDTQV
DNDEDYAEKSMPKGRKTPQKKTPNMIKSQK