Identifiers and Description

Gene Model Identifier

Contig17048.0.g64

Standard Name

CRY1a

Aliases

Contig17048_0_g64

Description

FAD binding domain of DNA photolyase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002954101.0000633497921574e-36FAD binding domain of DNA phot
olyase family p...
SGDYOR386W2.9998215087698487e-30PHR1 SGDID:S000005913, Chr XV
from 1066839-1068536, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17048.0.g64(coding)
ATGGAAAAGAAGAAGGTCAATAATAAGAGAAAGAGAGATGAAATCTCCAATACTGTGAAA
GTAGAAGAGGAGGAGAAGAAATCTTACGAGATTAAGGATGAGGAGCTGAAGCAAACGAAG
GTTAAAAAATTAAAAAAATCAAAGGAAAGTCCAGAGCTGGTATAAGGAGGGGAAGTTGGA
GATGAAACTAATAATAAAATGTAAAGAATAATTTTGTGGTTTAGGAATGATCTCAGACTC
CATGACAATGCCATCCTAAACTACGCTGTCTCTTAAAAGACAAAGAACAAGGAGATCATC
CCAGTGTATTCATTCGATCAAAGATTCTTAAACCGTAAGGTGAAGAAGTATGATACACTC
AAGTGTGGGCTTGTGCGCACTCGCTTCATTCTTGAATCTGCTTAAAATTTCAGGGACAGA
TTGGAGAAGATTGGCAGCAAACTATTGGTCACCATGGATAAACCTGAGGACTTTTTGCCA
TAGCTAATTGATAAGGATGTCGATAACACCATTGTGTATCAGGATGAGATATGCAGTGAA
GAATTAGCAGTAGAGAAGGCAGTAAAGGAATCTTGTGAGGGTTAAAAAATTGTAAACCTC
TGGGGATCAACTGTTTACCATGTTGATGATCTCGGCTTCCATCCAAAAGAACTCCCTCAC
ATCTATGGTAAATTTAGAGAAAAGACTGCAGATGTCAAAATCCGTCCACTCTTCGCCTAG
CCTAAGTCTGGATAGTTACCTTATGCAAAAGAACCCTCTCCATTAATGGAAGAGGCCTCC
AAATTTATGCCAACATTGAAGGACTTCGGCTTCACTAAAGAACAAATTGAAAAGCCAAAG
GACAAAAGAGCTTGTTATGATTTCGTGGGTGGTGAGGACAACGCTGTCAAGAGATTGAAC
GAGTATATCATGGGTACTAAGTCAGTAGGTAGCTATGCTATTACCAGAAATAATCTTATT
GGAGCTAACTATAGTTCTAAGTTTAGTCCTTGGTTAGCTTGTGGCGCTCTTTCACCCAAG
TACATTTACTATCAAGTGAAAGAATTTGAGAAGACTCATAAATCGAACGAATCAACTAAG
GTTTTCTTAGATGAGCTCTTCTGGAGAGACTTCTATAGATTTTGGGCTATTAAATACGGA
AACTAAATGTTCTCATCTTATGGAATATACAATAGAGAGTACTATAATTGGTAAGAAGAT
AGAGAAAATGTGAGAAGATGGAAGGAAGGATCAACTGGCATGCCAATCATTGACGCTTTT
ATGAGAGAATGTAATGAGACAGGATTTATGCCAAACAGAGGCAGGATGATTGTAGCTTGC
TACTTAACCATGGATCTCAAACACGACTGGAGAGAGGGTGCATATCATTTCGAAGAGAAG
CTTATTGATCACGATGTGCAAAGTAACTACGGTGGGTGGAATTTCTCAGCTGGAATAGGA
CCAGGAAGAGTATTGGTGTTCAACTCCATTAAGTAGTCTAAAGATCATGATAAGCACGGC
GAGTACATCAAAATGTGGGTTCCTGAACTCAAGAATGTCCCAATCGAGTATATTCATGAA
CCATGGACTATGCCAAAAGACTTGTAGAAGGGATCTAAATGCATCATTGGATAGGATTAT
CCACACCCAATAGATTGCCCTAAATACACTAACAAGAATTAGCATGTAAAAGATAAAGCT
GCTAAGAAAATCCAAATTGATTCAGAAAAAAAATTGAAATAAACTACACTCAAAAAGTGA


>Contig17048.0.g64(protein)
MEKKKVNNKRKRDEISNTVKVEEEEKKSYEIKDEELKQTKVKKLKKSKESPELVQGGEVG
DETNNKMQRIILWFRNDLRLHDNAILNYAVSQKTKNKEIIPVYSFDQRFLNRKVKKYDTL
KCGLVRTRFILESAQNFRDRLEKIGSKLLVTMDKPEDFLPQLIDKDVDNTIVYQDEICSE
ELAVEKAVKESCEGQKIVNLWGSTVYHVDDLGFHPKELPHIYGKFREKTADVKIRPLFAQ
PKSGQLPYAKEPSPLMEEASKFMPTLKDFGFTKEQIEKPKDKRACYDFVGGEDNAVKRLN
EYIMGTKSVGSYAITRNNLIGANYSSKFSPWLACGALSPKYIYYQVKEFEKTHKSNESTK
VFLDELFWRDFYRFWAIKYGNQMFSSYGIYNREYYNWQEDRENVRRWKEGSTGMPIIDAF
MRECNETGFMPNRGRMIVACYLTMDLKHDWREGAYHFEEKLIDHDVQSNYGGWNFSAGIG
PGRVLVFNSIKQSKDHDKHGEYIKMWVPELKNVPIEYIHEPWTMPKDLQKGSKCIIGQDY
PHPIDCPKYTNKNQHVKDKAAKKIQIDSEKKLKQTTLKK