Identifiers and Description

Gene Model Identifier

Contig16082.0.0.g98

Standard Name

CRNb

Aliases

Contig16082_0_0_g98

Description

HAT (Half-A-TPR) repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010769609.997093137033517e-262hypothetical protein
SGDYLR117C6.999054974866289e-109CLF1 SGDID:S000004107, Chr XII
from 384534-382471, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16082.0.0.g98(coding)
ATGAACGAACTCTAGAAGTAGTTAGCTTCCTAAGCGGAGTAACAAGCCAACTCAACTTCG
ACTGCCCTGCCAAACTAGCACTTGGGTATTATGCGAGTGCCCCAAACAAAGAACTACAAC
GCAGCTGAGATCTAAATCACAGCTGAGCAGCTCCTTAGAGAGTCACAGCTTTACAAAACG
GATGAGTCTTAGACATTTCAGCAAGTGATCAGGGATTCTGACGAATTGGACGAGTATAAA
TATAGGACGAGGAAGGAATTTGAAGACTCGATAAGGAAATAGAGGCATCACATGGGTACT
TGGATTAAGTATGCCGAGTGGGAAGCCAGTATTGCGGAGTTTGATAGAGCTAGAAGTGTC
TTTGAGAGAACCGTGGATGTTGATTTCGAGCATGTTACTCTTTGGTTGAAATATGCAGAG
ATGGAAATGAAAAATAAGTTCATAAATCATGCTAGAAATGTCTGGGAACGTGCTTGCAAG
CATCTCCCTAGAGTAGATCAATTCTGGTACAAGTATTCTTACATGGAAGAAATGGTAGGT
GAGTTTGACAGAGCAAGAAAAATCTTTGAAGATTGGATGACCTGGGAGCCTCAAGAAAAC
GCCTGGAATGCTTACTTGAAATTTGAAGAAAGACAGGGATAGCTAGATAAATGTAGAACC
ATTCTTGAAAGATACATAGATGTAAATCCTACAGTCAGTAGTTATATTAAAGCAGCTAAA
TTTGAAGAGTAACACCGTAGCAAAGACCAAGCAAGATTATTCTATGAGAGAGCTCTCGCA
GAATTAGGTCCAAAGGCTTTCGATGAGAATTTCTTTATCTAATTCACCAACTTTGAAATA
CGTTTCCATGAGCATGAAAGAGCCAAGATTCTCTACAAATATGCTCTTGATAATTTGCCT
AAGGAGAGAGCAAATAGGCTGTATCAGTAATTTTTGGAATTCGAGAAGCAATATGGTAGT
AGAGAAGAAATGGAGGATGTTATACTTACTAAACGTAGGCACTTCCTAGAAGCAGAAATC
GCAAAGCAGCAACAAGCATCTTCAGGGAATTAGGTCTATGACTATGACTTGTGGTTTGAT
TATACTAGACTAGAAGAGCAAAGTGGGAGTATTGAGAGAGCAAGGGAAATTTATGAGAGA
GCCTTGTAAAACGTGCCACCTGTTCTAGAAAAGAGATATTGGAAGAGATATGTCTACTTG
TGGATTAACTATGCTGTCTTTGAAGAGTTACAAGCATTGAATATAGAGAGAGCATAAGCT
ATTTATGAAAAATTACTTTTTGAAATGATACCACATGAACGTTTTATATTCTCAAAACTT
TGGATTATGTTTGCCTAATTCCTACTTAGACAAAAAAATCTCGATAGATGCAGAAAGGTA
TTAGGGCAATCAATGGGAAAATGTCCAAAATAGAAAATCTTCAAAGCCTACGCACAGATT
GAAATGCAGTTAGGCCAGTTGGATAGATGCAGGACTATCTACAACAAGTAAATTGAAATA
TTCTCATAAAATTCATCAGTATGGATTGACTATGCTGATTTTGAGAGTTAATTGGACGAA
GTGGATAGAGCAAGAGAGATCTATGAACTAGCAATTTCCAATCACAACTTGGATATGCCA
GAGAAAGTTTGGCAGTCTTATTTGGACTTTGAAATTAGCTTAGGTGACTTTGACAAAGTG
AGATCTCTTTATCAACGACTATTAAGTAAAAGTAAGCATCTAAAAGTATGGCTCTCCTAC
AGTAAATTTGAGTCAGAAAACGCCTAAGACCCCGACAAAGCCCGCAAAATATTCTTCCAA
GCTTACAACCATTTCAAAACCACAGAACCCGACCTCAAAGAAGAAAGACTCATGATTCTT
GAAAATTGGCTTAGATTTGAAGAAGGACCTCTAGGTGATATGACTCAATTAGAGCAAGTT
AGAGCTAAAATACCAAAGAAAGTAAAAAAGAGAAGAAAGGTCAAGGTTATCAATTAAGAG
ACTGGCGAGGAAGTGAACGACCAAGAAGGTGGCTGGGAAGAATACTACGACTATTTGTTC
CCAGATGATGCTATGGAATAAAAGAAGAGTTTGAAGATACTGGAAATGGCTCACAAGTGG
AAGAAAGACACTGCAACTACCACTGCCCCACTCAAGAAATGA


>Contig16082.0.0.g98(protein)
MNELQKQLASQAEQQANSTSTALPNQHLGIMRVPQTKNYNAAEIQITAEQLLRESQLYKT
DESQTFQQVIRDSDELDEYKYRTRKEFEDSIRKQRHHMGTWIKYAEWEASIAEFDRARSV
FERTVDVDFEHVTLWLKYAEMEMKNKFINHARNVWERACKHLPRVDQFWYKYSYMEEMVG
EFDRARKIFEDWMTWEPQENAWNAYLKFEERQGQLDKCRTILERYIDVNPTVSSYIKAAK
FEEQHRSKDQARLFYERALAELGPKAFDENFFIQFTNFEIRFHEHERAKILYKYALDNLP
KERANRLYQQFLEFEKQYGSREEMEDVILTKRRHFLEAEIAKQQQASSGNQVYDYDLWFD
YTRLEEQSGSIERAREIYERALQNVPPVLEKRYWKRYVYLWINYAVFEELQALNIERAQA
IYEKLLFEMIPHERFIFSKLWIMFAQFLLRQKNLDRCRKVLGQSMGKCPKQKIFKAYAQI
EMQLGQLDRCRTIYNKQIEIFSQNSSVWIDYADFESQLDEVDRAREIYELAISNHNLDMP
EKVWQSYLDFEISLGDFDKVRSLYQRLLSKSKHLKVWLSYSKFESENAQDPDKARKIFFQ
AYNHFKTTEPDLKEERLMILENWLRFEEGPLGDMTQLEQVRAKIPKKVKKRRKVKVINQE
TGEEVNDQEGGWEEYYDYLFPDDAMEQKKSLKILEMAHKWKKDTATTTAPLKK