Identifiers and Description

Gene Model Identifier

Contig17791.0.g69

Standard Name

CPSF4

Aliases

Contig17791_0_g69

Description

Zinc finger C-x8-C-x5-C-x3-H type (and similar)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYPR107C1.0004572433669413e-23YTH1 SGDID:S000006311, Chr XVI
from 742064-741438, Geno...
T. thermophilaTTHERM_003959500.00000000000020009182674645818hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17791.0.g69(coding)
ATGTTAGAAGAGGAAAAATTAAGTAGAAATTAAGTGCAGGCAATCATAGATTCCCAGAAC
CGCAGGGTTGACGAGAGCAAGAAAAAGAAGACAGTCTGTGTTCATTGGCTGGTTGGCAGG
TGCAAAATGGAGGAAAATTGCCCATTCTTGCATGTTATGGTTGAGGATAAGATTCCTCCT
TGTAGGTACTTTATATAAGATGGAGTATGTTCGAAGGGTGACAAATGCGTTTTTAGGCAT
GTAATACCACAAGAAAAGAGAACAGAAGACTGTCCTTACTATGAGAGAGGTTTCTGCAGA
ATGGGTCTCTTTTGTACATTCAACCACATTCATAAAAAGATCTGTGAGAATTACATGTAT
GGATTCTGCCCGAAAGGCCCAGATTGTGAGAAGGAGCACATTAAGTCAGTGATTGCAGAT
AATGACACAACTTTGAAAATTCTGGCAAACTTCCCAGACAACGAAAATTGGGCTGACAAA
TCTGCATTACAAGCAACCCATCAGTAGCAGTAATAACCCTGGCAGAAAGCTATGAACAAA
GTGAGATGTCACAGATGTGGAATTGTGGGTCACAAATCAACTTACTGTCAGGAGGAACAA
ATCACTCAGGAAGAACTTAATATCATTTTAGAGCAAGACGATCAATACAACATGTAGAAT
CAAACAGTGTTGTGCTTCAAGTGCAAGAGATACGGTCACTACGCGAATGTATGCCCAACC
AAGGGAATGCCAGCAAGTACAGCAGGTGGTCCAGATGGGCAGAATAGATTTGGAATGCTA
AACCCACTTTTAGATAACATGGGTAATTAAGCACCAAGTGCAGCAAGTGGAATGGATAGC
AACCAACCTTAAGATTAACTGAGGGGTGATCATGCAATGGATGGTGGCAATTAAAACGCT
GATTTGACTTAAAATCTAAGAAACTTAGTAAAACTGTTCGACAGCCAGGACTCAGGTGAT
CAGCAGTAGCAATAGTAAAATGGTAGAGCGAATCCCACTCAAACAGTGACAGTAAGCAAA
GTGTCAGTTCAAGATTTACCACTATAATTCGAGCAAATTGAGATGGCTGTAAACTTTTGC
GCTTATAACATTCAGAGAGAGGGCTACATGGCACTGCAGTGA


>Contig17791.0.g69(protein)
MLEEEKLSRNQVQAIIDSQNRRVDESKKKKTVCVHWLVGRCKMEENCPFLHVMVEDKIPP
CRYFIQDGVCSKGDKCVFRHVIPQEKRTEDCPYYERGFCRMGLFCTFNHIHKKICENYMY
GFCPKGPDCEKEHIKSVIADNDTTLKILANFPDNENWADKSALQATHQQQQQPWQKAMNK
VRCHRCGIVGHKSTYCQEEQITQEELNIILEQDDQYNMQNQTVLCFKCKRYGHYANVCPT
KGMPASTAGGPDGQNRFGMLNPLLDNMGNQAPSAASGMDSNQPQDQLRGDHAMDGGNQNA
DLTQNLRNLVKLFDSQDSGDQQQQQQNGRANPTQTVTVSKVSVQDLPLQFEQIEMAVNFC
AYNIQREGYMALQ