Identifiers and Description

Gene Model Identifier

Contig17827.0.g108

Standard Name

CPSF3L

Aliases

Contig17827_0_g108

Description

Beta-Casp domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam10996 ) Beta-Casp domain
  • ( pfam12706 ) Beta-lactamase superfamily domain
  • ( pfam00753 ) Metallo-beta-lactamase superfamily
  • ( pfam07521 ) RNA-metabolising metallo-beta-lactamase
  • ( pfam13483 ) Beta-lactamase superfamily domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003397904.999288603441066e-168RNA-metabolising metallo-beta-
lactamase famil...
SGDYLR277C1.9996609186508915e-82YSH1 SGDID:S000004267, Chr XII
from 699495-697156, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17827.0.g108(coding)
ATGGTCATAAAAGTAATACCTCTAGGTGCAGGATAAGATGTGGGAAGAAGTTGTGTCATA
GTAGAGCTTGGCGGACGTCGTCTAATGTTCGACTGTGGTATACATATGGTGAATTAGCAG
TAGTTTCCAGACTTCCATTTCTTACAAGGATCACAGCAGCAACCATTAGACTTTACGAAC
CATATAGATTGCGTATTAATAACTCACTTTCATTTAGATCATTGCGGTGCACTTACTTAT
TTCACTGAAGGAGTGGGATATCATGGACCTATACTTGCAACTCCTCCCACGAAGGCCATC
ATCCCATTGATGCTTGAAGATTTTAGAAAGGTTAGCTCTATGCAGCAGGGATAAAAAGGA
GGTGGTCAAGGTTCAGGTGGCAATTAGAACTCTATGAATCAAGACACTGCCTTTACATCA
GATATGATTAAAGCTTGTATAGCTAAGATTTCAACGATATAGCTTCATGAAACTCAAGTA
ATTAAGGGAGACATCAAAGTCACTGCTTATTATGCTGGCCATGTACTTGGAGCTTGCATG
TTTTATGTCGAATGTAACGGAGAATCTGTAGTATACACTGGAGATTATAACATGACTGCA
GATAGACATTTAGGCGCTGCTTGGATTGATAAGCTAAGACCTGATGTCTGTATTACTGAA
ACAACATATGCTACTACTATTAGAGATTCAAAAAGATCAAGGGAAAGAGAGTTCCTGAAA
GTTGTACATGAAACACTAGATAATGGTGGCAAAGTCCTAATACCTGTTTTTGCTCTTGGT
AGAGCTCAAGAACTCTGTGTATTGCTTGAAACTTACTGGAATAGAACTAATCTTTAATAT
CCAATTTACTTCTCGGGAGGATTGACAGAGAAAGCAAACTTCTACTATAAGCTCTTTATT
AACTGGACTAATGAAAAGATTAAGAAGACTTTTACAAAGAATCAAAACATGTTTCAGTTC
TAGCATGTTAAAACTCTTGACACTGCTTCTATCAAATCTGACTAGCCTATGGTATGTTTT
GCTTCTCCTGGCATGCTTCACGGAGGCTACTCGCTTTAAATCTTCAAAGATTGGGCAGGC
CAAGAGAAAAACACTTTAATCATTCCAGGATATTGCATGCCAGGAACTGTCGGTAACAAA
CTGCTAAGTGGTGAGAAGAAAATCAATATCGATGGAAGAGATATAGATGTGAGAATCAAG
ATCTACAATATGAGTTTTAGTGCACATGCTGACTCTAAAGGAATCATGGAGTTACTTTCG
CATTTGGAATCCAAGAATGTTGTACTAGTACACGGCGAGAAGCAAAAAATGGCGGTTTTA
AAGCTTTAGATTGAGGAGTAGCTCGACTAAAAATGCTATTATCCTGCTAATTATGCAACT
TTACAGATAAAGACTGATCCAAAAGTTGAAATGCTTATTAGCTCTCATATAATCAACAAA
ATGAACAGAATTTATAGTCAGTCAGGTCTCCATCTCTACAAGGCAAATTCCTAAATAAGC
CTGAGTGAATTCCTTATATACCTTGACAACAATTAAAACAATGACTTCCAGGATTGTCCA
ATTGAGATACTTAGCTCTACTGGAAACCTCAAAATCAAAAGTTAGCATTAGCAGTTTGAT
AGTGTCGAAGATAGCAATTTCAACACTCAGGAATCCATGAAAGATGAGCATATCAATAAT
AAAAAGGTTAAGAAAGGATCAGGAAAGAGTTCTAGATAAAAACTGATTATGGATAAGTAT
GAATCTGTCACTATGAATTTAGTTTGGAAGAGCAGATAACTCAACTAAGATATCTAAGTA
GATTAGGTCATGCAAATCTTAATGGATTTACTAGTAGATTCATTGATGATTCAGAAAAAA
GAAGCTTACAACATCAAGGAATTTCTATTTGAAAACGACGAAAAAGAATTGGCTTAAAAT
ATTGGTCAAACTCTTCTGACTAATTATCTCACATTTGATGAGGATATTAGAAAATTCAGT
GTGAGTTACGGTGCTCTTGAAAACGAAGTCGGTGAATGGCTCATAAAACTCATCCAAAAA
GCTATTCACAATCACTCTCGATAGTAAGAAAAATAACACAAATAAATTAAAGAACATCAA
GATGATGTGGTGGAATAAAATGATCAACTTTAAATGATGTAACATCAAACTATTAAATAA
GAAACATGTGATAATTATTAAGAGTAGTAAGATCAGATGATGGATAATGATGATGAAGGG
TAGATAATGGATTTGGATTGTAAGGCTGGTGGCGATTCTAACTAGATAATTAAAGAGTAG
GATGAAAGCAATATTGATGATAATAATTAAGATTGA


>Contig17827.0.g108(protein)
MVIKVIPLGAGQDVGRSCVIVELGGRRLMFDCGIHMVNQQQFPDFHFLQGSQQQPLDFTN
HIDCVLITHFHLDHCGALTYFTEGVGYHGPILATPPTKAIIPLMLEDFRKVSSMQQGQKG
GGQGSGGNQNSMNQDTAFTSDMIKACIAKISTIQLHETQVIKGDIKVTAYYAGHVLGACM
FYVECNGESVVYTGDYNMTADRHLGAAWIDKLRPDVCITETTYATTIRDSKRSREREFLK
VVHETLDNGGKVLIPVFALGRAQELCVLLETYWNRTNLQYPIYFSGGLTEKANFYYKLFI
NWTNEKIKKTFTKNQNMFQFQHVKTLDTASIKSDQPMVCFASPGMLHGGYSLQIFKDWAG
QEKNTLIIPGYCMPGTVGNKLLSGEKKINIDGRDIDVRIKIYNMSFSAHADSKGIMELLS
HLESKNVVLVHGEKQKMAVLKLQIEEQLDQKCYYPANYATLQIKTDPKVEMLISSHIINK
MNRIYSQSGLHLYKANSQISLSEFLIYLDNNQNNDFQDCPIEILSSTGNLKIKSQHQQFD
SVEDSNFNTQESMKDEHINNKKVKKGSGKSSRQKLIMDKYESVTMNLVWKSRQLNQDIQV
DQVMQILMDLLVDSLMIQKKEAYNIKEFLFENDEKELAQNIGQTLLTNYLTFDEDIRKFS
VSYGALENEVGEWLIKLIQKAIHNHSRQQEKQHKQIKEHQDDVVEQNDQLQMMQHQTIKQ
ETCDNYQEQQDQMMDNDDEGQIMDLDCKAGGDSNQIIKEQDESNIDDNNQD