Identifiers and Description

Gene Model Identifier

Contig18798.0.g40

Standard Name

CPSF3

Aliases

Contig18798_0_g40

Description

Beta-Casp domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam10996 ) Beta-Casp domain
  • ( pfam11718 ) Pre-mRNA 3'-end-processing endonuclease polyadenylation factor C-term
  • ( pfam00753 ) Metallo-beta-lactamase superfamily
  • ( pfam12706 ) Beta-lactamase superfamily domain
  • ( pfam07521 ) RNA-metabolising metallo-beta-lactamase
  • ( pfam13483 ) Beta-lactamase superfamily domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYLR277C9.996894623038854e-156YSH1 SGDID:S000004267, Chr XII
from 699495-697156, Geno...
T. thermophilaTTHERM_000867702.0007019863683806e-141RNA-metabolising metallo-beta-
lactamase famil...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18798.0.g40(coding)
ATGGACGTAAGAGTTCTTGGTTAGTAATTAGCTCAATAATTGCAAAGTCATTAGATTTAA
ACTCAGAGTGGCGATTTCTTGGAGATTACTCCTCTTGGAGCAGGTTGTGAAGTAGGAAGA
TCCTGTATTTACTTGGAATGTAAAGGAAAGAAAATTATGCTAGATTGCGGTATACATCCT
GGTAAAGATGGAGTTTAAGCTTTACCTTATTTTGATGTCATAAATCCTAAGGAGTTGGAT
TTGATATTAATCACTCACTTTCACGTTGATCATTGTGCAGGTCTGCCATATTTCTTAGAG
AAAACTGACTTCAAAGGGAAAGTATACATGACTCACCCTACTAAATCAATTTATAACTAT
GTGATGCAGGATTTTGTGAAGGTCAGCAATATTGCAATCGATGAGAAACTTTTTGATGAG
AATGACCTGAAAAATACTTTGGATAAGATATACATGTTGGACTATCATTAAGAAGTAGAA
GAAAATGGAATCAAATTCAGTTGCTATAGAGCAGGACATGTATTAGGTGCTTCTATGTTT
CTTATAGAAATTGATGGAGTAAAGATACTATACACAGGAGACTACTCGAGAGAAGAAGAC
AGACATCTAAAACCTGCTGAGCTTCCAAATTGCGAGGTGGATGTATTAATTGTTGAAAGT
ACTTACGGAGTTCAAATTCATGAGTAGAGAGATAAGAGAGAAGAAAGATTCACAAAGTTG
GTTCATGATATTGTGAAGAGAGGTGGTAAATGTTTGTTGCCTGTCTTTGCCCTTGGTAGA
GCCCAAGAAATTCTTTTGATTCTAAATGAATACTGGCAGAAGAATCCTGATATTTAAAAC
GTACCAATTTATTACTCTGGTAGTTTGGCATAAAAATCATTGACTGTGTTTTAGACTTAC
AGAAATATGATGGGAGACTAACTTAGAATGGAACTAGAAAGTGGAAATAATCCATTTCAT
TTTGAACCCATTACCACATTTAATGATGAGTCTGAATTTCCACTAGTTATTATGGCAAGT
CCAGGTATGTTATAAAATGGTCAAAGTAGAGACCTGTTTGTAAAATGGGCACCAGACCCA
AAGAATGGAATAGTCTTCACAGGTTATAGTGTCGAAGGTACGCTTGCAAAAAGTGTGATG
AACAGACCGAAGATACTAACAGTCGCTGAATAACAGGTAGAGCTGAAACTCTCGGTTGAA
TACATTTCATTTTCTGCACATGCTGATTACTAGCACACTTCAGAATACATAAAACAACTT
CAACCTCCAAATATTGTGCTAGTCCATGGAGATGCAAATGAAATGAAGAAATTATAGAAC
GATCTATAAGCTAGGTATAAAGATAAAATTAAGATTCTGACTCCAAAGAATTGTTAGCAA
GTCAGACTCAAATTAATTTCTAAAAAATCTGCCAAAATTATTGGATAGCTTGCTAGATAA
ACTGTTGAAAATTTAACTAACATTTAAATGCTAAGACAATCTCATCCCAATATTGATAGG
CACTTGCAAATTAAAAATCAAATCGATGGAGATGTCTAAATGATCGATACGACAACCATT
TAAAATTAGCAGGAAGAAAAGGTATCCAACTATGTAACAATAGATGGAATTTTTATAAAG
CAAGACTTTGACCATTTGATCTTGGATGAAGAGGAAATAGATAAATACACAACCTTAACT
AAATCTACTATGAAGTAAACAATCTTTATACCTTTTAAGTATGACATCTAAGTACTTAAC
TTCTACATCTATTCTTACTTTGCTGACGTCAAAGTAGAGTTCGGTAAATCAATAAAAACT
TAGACATAGGATGATTCTCATCAGTAGACATAATCCAAATTTGACATTAAATTCATAATC
GATGAAGAAATTGCTCTTTTCTACTTTCAAAAAGCAGGTATGTTACAATTGGAATGGATC
ACAAGCCCAAAGAGTGACTTAGTCGCCGATTCTTTAAGTTTGCTAGTTCTTTAAATAAAT
GAGAAGCCCACACCATAACTCTTAAACCTTATGGATCAAGTTGGAGAGCAAAGATCCTAC
CAAGAATTTGTGCAAAAACTGTATATAATTATGGAAAATCACTTTGATTACGTATCAATG
GATGTTGCACATTAGCAGATAACTATAGTTCATAATGAAAAACAAGCTCTAATTGACTTG
TATAAAAGAGATGTACAAGCTGATGATTAGTAATTATAAGAGACAATATAGTCCTATATT
AAACATCTAGAGGAAGTTCATGCACCAGTTGACCTCAAACATTGTTGA


>Contig18798.0.g40(protein)
MDVRVLGQQLAQQLQSHQIQTQSGDFLEITPLGAGCEVGRSCIYLECKGKKIMLDCGIHP
GKDGVQALPYFDVINPKELDLILITHFHVDHCAGLPYFLEKTDFKGKVYMTHPTKSIYNY
VMQDFVKVSNIAIDEKLFDENDLKNTLDKIYMLDYHQEVEENGIKFSCYRAGHVLGASMF
LIEIDGVKILYTGDYSREEDRHLKPAELPNCEVDVLIVESTYGVQIHEQRDKREERFTKL
VHDIVKRGGKCLLPVFALGRAQEILLILNEYWQKNPDIQNVPIYYSGSLAQKSLTVFQTY
RNMMGDQLRMELESGNNPFHFEPITTFNDESEFPLVIMASPGMLQNGQSRDLFVKWAPDP
KNGIVFTGYSVEGTLAKSVMNRPKILTVAEQQVELKLSVEYISFSAHADYQHTSEYIKQL
QPPNIVLVHGDANEMKKLQNDLQARYKDKIKILTPKNCQQVRLKLISKKSAKIIGQLARQ
TVENLTNIQMLRQSHPNIDRHLQIKNQIDGDVQMIDTTTIQNQQEEKVSNYVTIDGIFIK
QDFDHLILDEEEIDKYTTLTKSTMKQTIFIPFKYDIQVLNFYIYSYFADVKVEFGKSIKT
QTQDDSHQQTQSKFDIKFIIDEEIALFYFQKAGMLQLEWITSPKSDLVADSLSLLVLQIN
EKPTPQLLNLMDQVGEQRSYQEFVQKLYIIMENHFDYVSMDVAHQQITIVHNEKQALIDL
YKRDVQADDQQLQETIQSYIKHLEEVHAPVDLKHC