Identifiers and Description

Gene Model Identifier

Contig12888.0.g107

Standard Name

CPSF2

Aliases

Contig12888_0_g107

Description

Beta-Casp domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam10996 ) Beta-Casp domain
  • ( pfam13299 ) Cleavage and polyadenylation factor 2 C-terminal
  • ( pfam12706 ) Beta-lactamase superfamily domain
  • ( pfam00753 ) Metallo-beta-lactamase superfamily

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_009306503.998609120989657e-17hypothetical protein
SGDYLR115W0.000000000003998907168546896CFT2 SGDID:S000004105, Chr XII
from 377985-380564, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12888.0.g107(coding)
ATGTCAGCAATTGAGAATAACCATCAATTTCACGCAATAAATAACATTAAGGGGGAGCAA
CAACAAATAGTACCACTTGCTAATGACAATCTTAATTAATTGTCCTTATCTCATCCAGAT
ATCATGTTCATGAGTATCCTGAACAAATCTCAGCACTAATGCACTGCCAGTCTTTTGAAA
GTGGGAGATCTTACTATCTTACTGGATTGTGGAGCTAATGAATCTTATTCCCTAGACTAA
TTAAATTTGTTGAGGGACATAATCAAGGAGCAAAATGTTGACTTTATATTCTTGTCTCAT
GCTTCAATGATGCATGTCGGTGCTATACCATACTTGCAAGCAAATGGTTGTTTAGATTTC
CAGCTTAAAGTTATGAGTACTTCCCCTACTGCAAAAATGGGTGCACTAACTATGTATGAG
TTCTTTATTCAAAAGAAGGAAAGCGCAAACTTTGACTACTTTACACTATAAGACGTAGAG
AAATCATTTGAGAGGATTGAGCTGGTGTCTTACAATGAAAATAGAAAGATCAGAATGAGA
GAGACTGAATTGATTTTAAGTGCTTTACCTTCTGGTAACTCAATTGGAGGTGCTTGCTGG
AAGATAGAGTACAATAAATAAACTATCGTCTACGCTGTTGAGTTGAATGATAAACCCTTG
CATATCACCATTCCTATGAAGTTTGAGGATTTCAAGAATGCCAATATATTGATTACTAAT
GCATTTTTAACTCCCAAATCCTTCAAAAGTAATCAAAAGATCTAACAAGCCCCTAAAATT
TACTAATTCTTAAGTGAAGAGAAGTTGAAAATTAAGCTTGAAAAAGTTATAGCAGATAAT
ATGGGCTAAATTCTCATTCCTGTTACTGATAAAAATCGAATTCTTTAATGCTTAATCATG
CTTGAAAATATGTTCTAAACTAATTCTAAACTTTAATCCGTCTTCAAGAATCCACAAAAT
TAGTTGATGACAATGCCTATTGTATATTTAGAGTATATGAGTAGAGATACTTTAGGAGTG
GGAAGAAGTCACTTAGGCTGGATGAACTTCCAGGATAATAAAGTGTTCTAGGATATCGAT
GAAAACCCAATAAATTTCTAATTTGTTAAAGATATCTTCACTCTTGATGAATACAGGAAG
CTGGAGCACAGTCCAAGAATCATTGTGACATCATTGGCTTCATTTTCTCAAGGATACACA
AAGCAGCTGATTTATGAATTCTCATAAGTACCCAAGAATGAAATTGTCTTCCTGCAGACT
AGCAGCCCCTAAGTTTTTAAAGATTCTCTAGCTTACAATTTATTAAGAGGATAAAAAGAA
ATTACTATGAAAGATAGCAGTGTAATAGGCATATTAAATGGAGATGATCAACAAGATATT
CATACTAATTCTTACAACAATAAGTTAATTTTGGATAGAGCAGAATCTTTCTAGATGAGC
AGTGATCACACTTTGAATTTACAGGCTTCTCAAAATGCAAGCATGTTCTTAAGCTAAATT
GAAAGTAATCAGGTTGCCACAGATTAAAATAAAATGACATTTGCTTAAAATCAGTTGCTT
TAATCAAGAGAGAACTTTATGAATAAGCTCAATGAGAAACAATTTCTTAAGAACTTTCTG
CCAGGGTCATATCCAGTGTTTAGCTTGAATCCTGTAGATTTTTAAAAACCAATTACATTT
TATGGTGAAGAGAACGTTGTAGTTACAAATGACATAGAAATGAATGAGGAAGTAGCTGAA
GTCTAATAAGCCTTCAACAATATGATTAATGAAGGGAAATAAATCTAAACTGTCAACAGA
TTTAAGGAGCTTTAAAAGAAGTATGGAATGCAATTTTTGTATCACACTCAGGAGAATAGT
TTTCAGATCAGATGTAAAATATCCTACATACCATTTGAAGCAAGAATTGATAAAACTTCC
TTTGAACTTTTAATGAGATAAGTTCAACCAAAGGAACTAATTCTTATAAACTCCTCAAAG
AAAAAGTTTTAGAAATTGGATGAATTTATCAATATGAGTTAGATATAATGTAATATACAT
TACTCAGGCCTGTCTTTCTAAACTAGTCACATTATTGATGAGAATAAAGCAATTTCTTTC
TGTACAAATGCAGCTGTGAAATAAGTGTTCATAGATGATAGACTTTACAAATCCCTCCCT
ATTTAAAGAGTACATTAACGCTATGAAATTTCTAGAATCAAAGCAGCTCTAGAATTACCC
CAAAATACTGATTCTAACTCACTTTAAAATGCGCTTGTGAGTGGAAGCACTTTTGATTTA
TTAAAAGAAATACCCATGATAACGGAGACTGAGAAGGTGAGGGAACAATTTTAGAGGAAA
AATCTGTTTTTTAGAAGCAAAGACTATAAGCTAAGTCATTTGCAGAAATATCTAGAGACT
TAGAATATTCCAACTGTCATTGTGGATAAGTGTCTAAATTACCACGACTAAGTATTCATA
TATTTTGATAAAGACAGTGGGTAGATACGACTTGAAGGTATGATCTCAAAGGATTATTTT
GTGATAAGATAGTTGATTTATCACCACTTTGGTAGAATATGA


>Contig12888.0.g107(protein)
MSAIENNHQFHAINNIKGEQQQIVPLANDNLNQLSLSHPDIMFMSILNKSQHQCTASLLK
VGDLTILLDCGANESYSLDQLNLLRDIIKEQNVDFIFLSHASMMHVGAIPYLQANGCLDF
QLKVMSTSPTAKMGALTMYEFFIQKKESANFDYFTLQDVEKSFERIELVSYNENRKIRMR
ETELILSALPSGNSIGGACWKIEYNKQTIVYAVELNDKPLHITIPMKFEDFKNANILITN
AFLTPKSFKSNQKIQQAPKIYQFLSEEKLKIKLEKVIADNMGQILIPVTDKNRILQCLIM
LENMFQTNSKLQSVFKNPQNQLMTMPIVYLEYMSRDTLGVGRSHLGWMNFQDNKVFQDID
ENPINFQFVKDIFTLDEYRKLEHSPRIIVTSLASFSQGYTKQLIYEFSQVPKNEIVFLQT
SSPQVFKDSLAYNLLRGQKEITMKDSSVIGILNGDDQQDIHTNSYNNKLILDRAESFQMS
SDHTLNLQASQNASMFLSQIESNQVATDQNKMTFAQNQLLQSRENFMNKLNEKQFLKNFL
PGSYPVFSLNPVDFQKPITFYGEENVVVTNDIEMNEEVAEVQQAFNNMINEGKQIQTVNR
FKELQKKYGMQFLYHTQENSFQIRCKISYIPFEARIDKTSFELLMRQVQPKELILINSSK
KKFQKLDEFINMSQIQCNIHYSGLSFQTSHIIDENKAISFCTNAAVKQVFIDDRLYKSLP
IQRVHQRYEISRIKAALELPQNTDSNSLQNALVSGSTFDLLKEIPMITETEKVREQFQRK
NLFFRSKDYKLSHLQKYLETQNIPTVIVDKCLNYHDQVFIYFDKDSGQIRLEGMISKDYF
VIRQLIYHHFGRI